PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_025705
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family LBD
Protein Properties Length: 486aa    MW: 55300.6 Da    PI: 5.0373
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_025705genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260131.63.4e-41101091100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrrkCa dCv+apyf a+qp+kf  vhk+FGasnv kll++lpee+r+da++slvyeA+ar++dP++G++g+i+ l+++l+ql+ +l  +k
  DCAR_025705  10 PCAACKLLRRKCAVDCVFAPYFRADQPQKFSSVHKVFGASNVAKLLNELPEEQRKDAANSLVYEANARLKDPIHGCMGLISILKRKLKQLQMDLYNAK 107
                  7********************************************************************************************99988 PP

       DUF260  99 ee 100
                  +e
  DCAR_025705 108 KE 109
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.5499110IPR004883Lateral organ boundaries, LOB
PfamPF031953.9E-4010107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 486 aa     Download sequence    Send to blast
MYSTPSNFSP CAACKLLRRK CAVDCVFAPY FRADQPQKFS SVHKVFGASN VAKLLNELPE  60
EQRKDAANSL VYEANARLKD PIHGCMGLIS ILKRKLKQLQ MDLYNAKKEL ATYIGPSAML  120
PIFQGTENFL PQYQQEQALQ PQMMPYNMQP AQVMQPHLQQ LQKLAPYSMQ QGQMRPYNVQ  180
QAHQMRPYNM QQAHQMRPCN IQQAQMGTCN EQQAEIMGGL QQTVANLSPL EIHQQHQYQQ  240
MMEAEKVAAA LAAVREQERL RRYESQKVFA AKEQELLRDN ELKELEILRE QEYYKNHMAQ  300
HIAKREEEVI LRTYREKQQV AFAQQAALEQ QAALEQQATF AQQAALEQQA ALVQQAAFAQ  360
QQGPQSDLLG GYDITGQGQG QILSDELTQM SVPAGVTLES TLASLEGPYQ IQQDTQDDHV  420
RDHHQQLDMA SRLFLEEQEL QALALQQPLQ FDLQLEELLL QFQQHQDGGE EEVGSFDPLS  480
MAPLE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-4331134114LOB family transfactor Ramosa2.1
5ly0_B2e-4331134114LOB family transfactor Ramosa2.1
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19197LKRKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017218016.10.0PREDICTED: transcription factor SPT20 homolog
TrEMBLA0A161ZQA40.0A0A161ZQA4_DAUCS; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.16e-58ASYMMETRIC LEAVES 2-like 1