PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_025704
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family G2-like
Protein Properties Length: 299aa    MW: 33295.5 Da    PI: 7.8237
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_025704genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like79.24.9e-25223278156
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                  kprlrWt++LH++F++av++LGG+++AtPk+i   + ++ Lt ++vkSHLQk R +
  DCAR_025704 223 KPRLRWTHDLHREFMRAVDELGGPNVATPKKIIAKIPMHNLTTDEVKSHLQKCRQH 278
                  79**************************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.031220280IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-22221281IPR009057Homeodomain-like
SuperFamilySSF466897.53E-13221281IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-20223278IPR006447Myb domain, plants
PfamPF002492.4E-6225275IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MDIDLNSSLL YLNVSDLMAH IAVIDNTSEK VEKLNDYVKE LNAEMIRIKE SNCHSPLCIL  60
ILTEAIQKLE KEIQHYYKDM KDNREIEGRV TLENGNPKGA EMPGKSSDAN KGNSMSSIQL  120
GGKSIAYDTT KQTDAVHDNS SGSMREIAGS YENPRTQNNV NINQSGSAVI HYQGESRVII  180
RETSNFNNVQ HSSIAMVGLN FSGNYVTHVN HHPPASMMDP QKKPRLRWTH DLHREFMRAV  240
DELGGPNVAT PKKIIAKIPM HNLTTDEVKS HLQKCRQHAR KSNLAAQTTS AALPHNPH*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017217392.10.0PREDICTED: putative two-component response regulator ARR13
TrEMBLA0A161Y8730.0A0A161Y873_DAUCS; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.13e-20G2-like family protein