PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_025678
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family B3
Protein Properties Length: 330aa    MW: 37075.7 Da    PI: 9.0789
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_025678genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B346.47e-15251071099
                  HHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
           B3  10 vlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                  ++ks  l++p kf++++gg+ ++   + l+ +    W+v +  ++  g+++l++GW +F+k   L+ g f+ F+++g+ +f  +v +f++
  DCAR_025678  25 SSKS-KLTIPEKFVRKYGGELQG--GVLLKAPGAPPWSVDV--QREEGKVWLRNGWPQFAKFYSLCFGHFIFFEYQGNCNF--KVVIFDT 107
                  4444.5***********888555..59**************..**********************************9999..8888886 PP

2B354.32.5e-17225311191
                  EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE. CS
           B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefe 91 
                  f+ v+ ps+v+k+  l+l k++++++    ++++++ +     rsW vk++   +s+r  l+ GW++F+++n L +gD++vF+l++ s++ 
  DCAR_025678 225 FKVVMQPSYVGKTYGLYLRKSCLKSYI---RKGVDVLILRIARRSWVVKCR-VVRSNRLKLGCGWQQFAEDNALAVGDVCVFELVSPSKKL 311
                  778999******************994...25779***************6.56667999***********************99866553 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019368.83E-2011108IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.7E-1911108IPR015300DNA-binding pseudobarrel domain
CDDcd100173.22E-1514106No hitNo description
PROSITE profilePS5086312.18215108IPR003340B3 DNA binding domain
SMARTSM010192.5E-1216108IPR003340B3 DNA binding domain
PfamPF023625.0E-1225107IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.4E-17218318IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.06E-19221319IPR015300DNA-binding pseudobarrel domain
CDDcd100174.71E-18223318No hitNo description
SMARTSM010193.7E-14225320IPR003340B3 DNA binding domain
PROSITE profilePS5086311.575225320IPR003340B3 DNA binding domain
PfamPF023622.1E-15225315IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009909Biological Processregulation of flower development
GO:0010048Biological Processvernalization response
GO:0005654Cellular Componentnucleoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MEASFTSHHH AKARCFFKII LCEISSKSKL TIPEKFVRKY GGELQGGVLL KAPGAPPWSV  60
DVQREEGKVW LRNGWPQFAK FYSLCFGHFI FFEYQGNCNF KVVIFDTSTT EIDYPVQFEE  120
RSGSDQLQVF KKKQVHSGCD AACYLGESLK GRLLKEKIAE ALSETSISDE NEHGGIEKPS  180
HANGTPHDIP MRQHIVKAGG VSSPAEEKDR AHARAKALKS IHPSFKVVMQ PSYVGKTYGL  240
YLRKSCLKSY IRKGVDVLIL RIARRSWVVK CRVVRSNRLK LGCGWQQFAE DNALAVGDVC  300
VFELVSPSKK LIDVVIHRAV KEEEEEDIN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A3e-1520531829141B3 domain-containing transcription factor VRN
4i1k_B3e-1520531829141B3 domain-containing transcription factor VRN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7591893
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.13e-36B3 family protein