PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_025352
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family TCP
Protein Properties Length: 424aa    MW: 45112.9 Da    PI: 6.7935
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_025352genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP114.91.1e-3579164287
          TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsss 87 
                  ++ k++++++hTkv+gR+RR+R++a  aar+F+L++eLG+++d++ti+WLlq+a+p i+ +tgt++ +a++++++  ++s ++s s
  DCAR_025352  79 TVPKRPSKDRHTKVDGRGRRIRMPAMSAARVFQLTRELGHKSDGETIQWLLQKAEPHIIGATGTGTVPANFTTQSPVVNSRGSSFS 164
                  56799****************************************************************88855555555443222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036343.5E-3185189IPR005333Transcription factor, TCP
PROSITE profilePS5136925.44585139IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 424 aa     Download sequence    Send to blast
MDLKHLNKTN NKPQTTAATA TVAPEHRHRQ HHQVDEKSSP LNMALISTQP TNPNPITTPQ  60
INSSLAIPTT GSNPIIAQTV PKRPSKDRHT KVDGRGRRIR MPAMSAARVF QLTRELGHKS  120
DGETIQWLLQ KAEPHIIGAT GTGTVPANFT TQSPVVNSRG SSFSVASSMS AAPQYGPFGV  180
AHNGGYSQML QNVLVPDQMS RGISGIRDDR SGSGNDEGGI ENETVDDCSR KRFRGNLFSG  240
DEQVSGDSSS ASDKRVKSCL EEAGGSDLSQ CNGMVPMWAV APAASAGSGN MFWMFPFTAN  300
AGGGIGDDGV CDKVPISPFT PPSHNVKRNA RQPAPHFMSR FNGQGNVELQ GGDANALQLG  360
LMLEQQQSQE QLGFGMNETN LGMLASFSAR GGFDIKSEQK QASEQQHQDS QASDGGEDEA  420
NSC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017216233.10.0PREDICTED: transcription factor TCP8
TrEMBLA0A164U0S20.0A0A164U0S2_DAUCS; Uncharacterized protein
STRINGEOX971607e-77(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24824201
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58100.17e-47TCP family protein