PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_025262
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family ARF
Protein Properties Length: 667aa    MW: 75138.3 Da    PI: 7.3334
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_025262genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B373.62.4e-23103203198
                  EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE. CS
           B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefe 91 
                  f+k+lt sd++++g +++ +k+a+e+       +  ++  ++l+ +d++g +W++k+ +r++++r++lt+GW+ Fv++++L +gD++vF   +++++e
  DCAR_025262 103 FVKILTASDTSTHGGFSIFRKHANEClppldvtQATPT--QDLVAKDLHGFEWRFKHVFRGQPRRHLLTTGWSTFVSSKRLIAGDSFVFL--RDDGGE 196
                  89****************************97644444..58************************************************..568999 PP

                  .EEEEE- CS
           B3  92 lvvkvfr 98 
                  ++v+++r
  DCAR_025262 197 MRVGIHR 203
                  ***9987 PP

2Auxin_resp103.33.1e-34229308183
   Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                  a+ha++t++ F v+Y+Pr+  s+F+v+++k+++a+   +s+GmRfkm+fe+eds+err+sGt+vgv++l+p +W++SkWrsLk
  DCAR_025262 229 ASHAITTRTLFVVYYKPRT--SQFIVRLNKYMEAVAYGFSLGMRFKMKFEGEDSPERRFSGTIVGVENLSP-QWSDSKWRSLK 308
                  789***************6..9*************************************************.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.66E-3792232IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.6E-3796218IPR015300DNA-binding pseudobarrel domain
CDDcd100174.67E-20101203No hitNo description
PROSITE profilePS5086312.167103205IPR003340B3 DNA binding domain
PfamPF023622.8E-21103203IPR003340B3 DNA binding domain
SMARTSM010196.2E-22103205IPR003340B3 DNA binding domain
PfamPF065073.3E-31229308IPR010525Auxin response factor
PfamPF023092.4E-13534635IPR033389AUX/IAA domain
SuperFamilySSF542771.18E-13543627No hitNo description
PROSITE profilePS5174526.256551632IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 667 aa     Download sequence    Send to blast
MIFMQSYGSH VQALWLRFPV GMRECITSLR LQASTNQELD QHIPKFNLPS KILCRVVNVQ  60
LLAELDTDEV YAQITLHPEV EQAEPTSPDP CIADPPKPPI HSFVKILTAS DTSTHGGFSI  120
FRKHANECLP PLDVTQATPT QDLVAKDLHG FEWRFKHVFR GQPRRHLLTT GWSTFVSSKR  180
LIAGDSFVFL RDDGGEMRVG IHRLAQHQSP MPPSVISSQN MHLGVLATAS HAITTRTLFV  240
VYYKPRTSQF IVRLNKYMEA VAYGFSLGMR FKMKFEGEDS PERRFSGTIV GVENLSPQWS  300
DSKWRSLKIQ WDEPASIHRP LRVSAWDIEP FVASKSSDLA LAMKIKRPRP VGNHLSDTTA  360
WYAATPFWYA GSNTTVEQSS LGGTTEFEYI AKQVVWPPKK KEQHDNFINH FSRGLTDESW  420
KDSVNLFRES AQDKPYVTTP PVMPEYDSPA SSRAHNGLVH DQVEQVRRTE TSASCRLFGI  480
DLRNSNSIQS PTKKVTDSFI ATDGGLQASS DTLLEVDRAR NLDLRKVKEQ VLAEAPKKET  540
DSKHGSNTSK RTRTKVQMQG IAVGRAVDLA LVEGYDDLIT ELERMFEIKG ELKERKNWQV  600
VYTDREGDMM LVGDDPWLEF CGIAKKIFIY TTEEVKKMSG NCKLPGSASD GEEKIVSIES  660
ETKCEV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1441833144355Auxin response factor 1
4ldw_A1e-1441833144355Auxin response factor 1
4ldw_B1e-1441833144355Auxin response factor 1
4ldx_A1e-1441833144355Auxin response factor 1
4ldx_B1e-1441833144355Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1345349KRPRP
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017219170.10.0PREDICTED: auxin response factor 11-like isoform X1
RefseqXP_017219171.10.0PREDICTED: auxin response factor 11-like isoform X2
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLA0A164TZ040.0A0A164TZ04_DAUCS; Auxin response factor
STRINGVIT_15s0046g00290.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23472450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.20.0auxin response factor 9