PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_023921
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family Nin-like
Protein Properties Length: 985aa    MW: 109088 Da    PI: 5.2533
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_023921genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK89.92e-28589639252
       RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                  e ++sl +l++yFs+++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki+++
  DCAR_023921 589 ERNVSLAVLQQYFSGSLKDAAKSIGVCPTTLKRICRQHGISRWPSRKINKV 639
                  789**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.859572659IPR003035RWP-RK domain
PfamPF020427.7E-26591639IPR003035RWP-RK domain
SuperFamilySSF542771.28E-19877967No hitNo description
Gene3DG3DSA:3.10.20.2401.4E-21882964No hitNo description
SMARTSM006666.0E-16885967IPR000270PB1 domain
PROSITE profilePS5174517.961885960IPR000270PB1 domain
PfamPF005642.9E-13886964IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 985 aa     Download sequence    Send to blast
MADPFSSKER DVNWDSPRTE MNSTDGKTSY SSTEDPHSNF EDMMNFDTYA GWCTSPSTSD  60
KMPESYSLLP LAKDCMISGP LSFTQDSFES FCVIDNDVRS LVRAGETMMF DQTDPEFDFP  120
LDFDDKDDGH AINNSHFCQQ NNTMEIKNCI IARPFPPPLE ERMIKALSLF MESSGGGILA  180
QLWVPVKDGD QLKLSTCEQP YLLDRMLAGY REISRRFTFP AEVEPGSSLG LPGRVYASKI  240
PEWTSNVGYY SKKEYLRVQH ALENEVRGLV AIPIFSGNPR EMSCSAVLEL VYLKEKANFD  300
LEMENVCHAL QAVDLRSTAP PRFSPRFLSN NHRAALAEIT DVVRAVCHSY VLPLALTWIP  360
CTYDNGGGED IYSIRVRGDK TKSGEKCILC IEESACYVNE RETQGFVHAC AEHYLEEGQG  420
IAGRALQSNH PFFSTDVREY DITDYPLVHH ARKFGLNAAV AIRIRSTYTQ NDDYIIEFFL  480
PRTMTGNSEL LLNNLSNTMQ KICRSLRRVS EAELLEQSGA LPGIKKGLVT KSPTGTFSSR  540
SNQHELINSN ITCGDQVHKS THVGMETDGS AQQATSSKRV LEKKRSTAER NVSLAVLQQY  600
FSGSLKDAAK SIGVCPTTLK RICRQHGISR WPSRKINKVN RSLKKIQTVL NSVEGVEGGL  660
KIDPSTGNVV TSGSTFENFG DFGASKNFLF TNKSEPECYE MAENMSMARP SSCSNEKNDV  720
KVEHESGANG NQVNSCALQN WKRENNSSIM FSEWLNNSDV ADPIGKLINP GIGYGGGSDS  780
SGSYFSKEDS KICGLNSGDM ILEKYDSLLK CHSSSSIAVA NEMYTGARVS STRDDGASLA  840
QVNQPTTSSM TDSSNASTTH GNSSSSPDIG EPKGSKTPIC EANSRITIKA TFKEDTIRFK  900
FDPYLGCFQL YEEIAKRFKL QIGTFQLKYM DDEKEWVIMA NESDLLECLE ILDFMGTRNV  960
KFQVCDVVFG MGSSSSSNFV TGGL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017219315.10.0PREDICTED: protein NLP9-like
RefseqXP_017219316.10.0PREDICTED: protein NLP9-like
TrEMBLA0A161WR290.0A0A161WR29_DAUCS; Uncharacterized protein
STRINGEOY047740.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA39812445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43500.20.0Nin-like family protein