PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_023678
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family G2-like
Protein Properties Length: 353aa    MW: 39014.2 Da    PI: 8.5593
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_023678genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.94.1e-32186241156
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                  k+r++W+peLH+rF++a++qLGG+++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  DCAR_023678 186 KARRCWSPELHRRFLQALQQLGGAHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 241
                  68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.319183243IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-28184244IPR009057Homeodomain-like
SuperFamilySSF466892.12E-18184244IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-27186241IPR006447Myb domain, plants
PfamPF002499.7E-8188239IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MQKSLDYIES LEEERRKIQV FQRELPLCLE LVSQAIEKCK KEFYRQRQEC SEQTSSEGPV  60
LEEFMPIKRA SSSEEDEQNS KKAKIICVTE SNRSEKSSKK SDWLRSVQLW NQTPDPPSNK  120
EDAPRKVTVV EVNKNGNGGA FHPFKREEKR VVVEAPPADG AASSTAETGG SSGGCKGEEK  180
DDSHRKARRC WSPELHRRFL QALQQLGGAH VATPKQIREL MKVDGLTNDE VKSHLQKYRL  240
HTRRPSPSSN NAQAPQFVVV GGIWVPPPPE YTTTNANSGE AGSIRSPPPN GIYAPKATLP  300
NAVREEATTN NPTQQSETNY SDKNGSYSKT ASRSESPSTS SSTHTTTASP AY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-14186239154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-14186239154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-14186239154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-14186239154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in phosphate signaling in roots. {ECO:0000250|UniProtKB:Q9FX67}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00160DAPTransfer from AT1G25550Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017216413.10.0PREDICTED: uncharacterized protein LOC108194033
SwissprotQ9FPE82e-94HHO3_ARATH; Transcription factor HHO3
TrEMBLA0A164SRW50.0A0A164SRW5_DAUCS; Uncharacterized protein
STRINGVIT_01s0011g03110.t011e-131(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52192438
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.16e-82G2-like family protein
Publications ? help Back to Top
  1. Nagarajan VK,Satheesh V,Poling MD,Raghothama KG,Jain A
    Arabidopsis MYB-Related HHO2 Exerts a Regulatory Influence on a Subset of Root Traits and Genes Governing Phosphate Homeostasis.
    Plant Cell Physiol., 2016. 57(6): p. 1142-52
    [PMID:27016098]