PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_023538
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family BBR-BPC
Protein Properties Length: 357aa    MW: 39887.3 Da    PI: 10.1957
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_023538genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind272.42.3e-8313561301
    GAGA_bind   1 mdddgsrernkgyyepaaslkenlglqlmssiaerdaki....rernlalsekkaavaerd..................................... 57 
                  mdd g + rn+ +y ++ +   nl+l+l+ s+ er  +     re+ + l ++ +a+++                                       
  DCAR_023538   1 MDDGGLNLRNWNMYGQHYNKPGNLNLHLFPSL-ERHVQNpflgRESSVLLNHNGGAFHPSLskstahmdpgvnnwahprdryvqmisansglaafheh 97 
                  88888877999999999777789999999999.56665568897777766666666643333444444455555555555888888888888887777 PP

    GAGA_bind  58 ....................maflqrdkalaernka.lverdnkllalllvenslasalpvgvqvlsgtksidslqqlsepqledsavelreeeklea 134
                                            d+ +++   + + +++   +++++v++s ++ + + +q++s   s    ++  +p  + s   l++++++e+
  DCAR_023538  98 pgahsmnmlqqqehsespkdARVCLEDMHVKQEGGSpVKKKKRTDVNMEPVSDSWVHRDRFVQQMVSANPSFAGFHE--HPPAH-SMHMLQHQQQSES 192
                  76666444444444433333333344444444332202233333344555555555555555555544444443333..22221.1122334444555 PP

    GAGA_bind 135 lpieeaaeeak.ekkkkkkrqrakkpkekkakkkkkksekskkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWq 231
                  ++i  +  ++k e  ++   ++ +++ ++k +k++k+++ +k++ ++ +  +r+k  kks+++v+ng++lD s++P+PvC+CtG+++qCY+WG+GGWq
  DCAR_023538 193 PKIGMEDVDVKkEIGEPV--KKRQSAAASKPRKPRKSPSIPKENGSSTG--HRVKPAKKSMNVVINGMDLDFSSIPIPVCTCTGTPQQCYRWGCGGWQ 286
                  555444333330333333..34445566777788887777777776666..79********************************************* PP

    GAGA_bind 232 SaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                  SaCCtttiS+yPLP+stkrrgaRiagrKmSqgafkk+LekLaa+ y+++n++DL+ hWA+HGtnkfvtir
  DCAR_023538 287 SACCTTTISMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAADNYSFANAIDLRYHWARHGTNKFVTIR 356
                  *********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012261.5E-1101356IPR010409GAGA-binding transcriptional activator
PfamPF062171.5E-91130IPR010409GAGA-binding transcriptional activator
PfamPF062171.6E-83142356IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MDDGGLNLRN WNMYGQHYNK PGNLNLHLFP SLERHVQNPF LGRESSVLLN HNGGAFHPSL  60
SKSTAHMDPG VNNWAHPRDR YVQMISANSG LAAFHEHPGA HSMNMLQQQE HSESPKDARV  120
CLEDMHVKQE GGSPVKKKKR TDVNMEPVSD SWVHRDRFVQ QMVSANPSFA GFHEHPPAHS  180
MHMLQHQQQS ESPKIGMEDV DVKKEIGEPV KKRQSAAASK PRKPRKSPSI PKENGSSTGH  240
RVKPAKKSMN VVINGMDLDF SSIPIPVCTC TGTPQQCYRW GCGGWQSACC TTTISMYPLP  300
MSTKRRGARI AGRKMSQGAF KKVLEKLAAD NYSFANAIDL RYHWARHGTN KFVTIR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ9SKD04e-74BPC1_ARATH; Protein BASIC PENTACYSTEINE1
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01930.22e-70basic pentacysteine1