PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_023529
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family G2-like
Protein Properties Length: 583aa    MW: 65322.9 Da    PI: 5.7837
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_023529genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like506.6e-162913212555
      G2-like  25 ekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  ++AtPk +l++m+v gLt++hvkSHLQ+YR+
  DCAR_023529 291 DEATPKLVLQMMDVRGLTISHVKSHLQMYRS 321
                  79****************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF561121.21E-847293IPR011009Protein kinase-like domain
Gene3DG3DSA:3.30.200.205.2E-25783No hitNo description
SMARTSM002202.6E-848290IPR000719Protein kinase domain
PfamPF000692.9E-638290IPR000719Protein kinase domain
PROSITE profilePS5001144.5138290IPR000719Protein kinase domain
PROSITE patternPS0010701437IPR017441Protein kinase, ATP binding site
Gene3DG3DSA:1.10.510.102.3E-5484281No hitNo description
PROSITE patternPS001080126138IPR008271Serine/threonine-protein kinase, active site
TIGRFAMsTIGR015573.6E-11271322IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.604.0E-16282323IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006468Biological Processprotein phosphorylation
GO:0003677Molecular FunctionDNA binding
GO:0004672Molecular Functionprotein kinase activity
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 583 aa     Download sequence    Send to blast
MLVTWLQYEY LKKIGEGSYG TVHKCRKSVN GEIVAIKTIL FYDYEGVPRS VMRETNLLKQ  60
MDHPNIVKLL EVLTANNKVS LVLEYADYDL QKFILSDPAN TRDPHFIKRL LHDILSGVQY  120
CHRNRIIHRD LKLENLLINS QDKIVKLADF GLSRTIDTPL GPLTKQVGNL NHMAPEALLG  180
SAQYSTPIDI WAVGCMFVEI VTHQDLFAGF SSSILLAKIA RTIGTPDEQI WPGVTAMFPP  240
NVMRQQFPPK DFAEIAPGLE PAGINLLSRM LRWNPSERIT AAEALAHEYF DEATPKLVLQ  300
MMDVRGLTIS HVKSHLQMYR SMKSDDGINK DESLIHQRRK QSLEDHYDGY IDQEATGSDQ  360
YASLLLTNLS TEESDSKDQI FFMSPKAPQT KRARIDAMSC NSADQSLQHC SQRISETLLT  420
RDQYYFDDYM QLAGEKSEVN KEGLLSFYRS QAAPMATAFS LPHDLFNNIS PFANHANAVL  480
EESDFFKVSE EEDKTCSSLR SCKLESSEDK HQNEAEDGGG CGLSLSLSLQ HPCTQRSNVS  540
SVSEISETIS SSYSRHDFSS CHGTSSGKPN LSLNLSIALC DT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2iw8_A7e-8382948294CELL DIVISION PROTEIN KINASE 2
2iw8_C7e-8382948294CELL DIVISION PROTEIN KINASE 2
4eon_A9e-8382946292Cyclin-dependent kinase 2
4eon_C9e-8382946292Cyclin-dependent kinase 2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017217988.10.0PREDICTED: cell division control protein 2 homolog
TrEMBLA0A164SNW40.0A0A164SNW4_DAUCS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA54332238
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12020.27e-19WRKY family protein