PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_023351
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 477aa    MW: 53158.1 Da    PI: 5.4896
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_023351genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS247.84.2e-76984675374
         GRAS   5 LlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn.sseelaalkl....fsevsPilkfshlt 97 
                  Ll+ A+ v+++++++a++lL+  s+las +g+p+qRl+ yf++AL++r+ r+   +++  +   +++    +e++ ++k     +  + P       +
  DCAR_023351  98 LLSSADKVANEQFSRARKLLSMCSHLASHTGNPVQRLVYYFAQALKERIDRKIGIISSEGREDCKRWLLnLDEAIISFKPpllaYGIAIPSCLAYKSA 195
                  8999***********************************************88888887776666665458888888876777688899999999999 PP

         GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeL 194
                    qaIl+ +++++r+H iD++i +G++Wp L+qaLa R e p  +l iT+++    +s+ ++ etg+rL++fA++lg+pf+f+++++++++dl+ +++
  DCAR_023351 196 GIQAILDPMATATRIHLIDLGIRNGMHWPFLMQALAVRHECPLeTLTITALVT---SSEVMIMETGKRLSQFASTLGLPFSFKAVLVSDMNDLKEDSF 290
                  99************************************966544********9...57999************************************* PP

         GRAS 195 rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgr 292
                  ++++gE + + +++ l + + ++ + e+    +++++k+l P+v+v+veqead+ s++F++rf+  l +ysa+fdsl+  +   + +r+ +E+ ++g 
  DCAR_023351 291 KIESGERIGIYSSFILRNYVGQHEQFEN----LMRIIKNLHPTVMVMVEQEADTKSPEFMDRFTGGLIHYSAMFDSLDICFDGSHPQRMPLEEDYFGA 384
                  *******************988888888....****************************************************************** PP

         GRAS 293 eivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                   i+++v+   +er     + + Wr+ l+++   +  ls++a  qa+ ++++ + s   ++  + ++l+ gW++ p++s+S+W+
  DCAR_023351 385 GIRQIVTFDVEERASLDMKIKDWRALLNSFNIVEKDLSSSALYQANIVIENSElSSLCTLSMDGKCLLSGWRGTPIFSLSVWK 467
                  *****************************************************9999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098536.12868446IPR005202Transcription factor GRAS
PfamPF035141.4E-7398467IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 477 aa     Download sequence    Send to blast
MDATNESSSL GSLELLSTFG CRLKRLRVEQ GNDTSNNAVS GPNRKDLSTS DIVKVAMDKF  60
RGLTAQSCSD PCMLVHSSNG YSGLYSEIDD DVESVLFLLS SADKVANEQF SRARKLLSMC  120
SHLASHTGNP VQRLVYYFAQ ALKERIDRKI GIISSEGRED CKRWLLNLDE AIISFKPPLL  180
AYGIAIPSCL AYKSAGIQAI LDPMATATRI HLIDLGIRNG MHWPFLMQAL AVRHECPLET  240
LTITALVTSS EVMIMETGKR LSQFASTLGL PFSFKAVLVS DMNDLKEDSF KIESGERIGI  300
YSSFILRNYV GQHEQFENLM RIIKNLHPTV MVMVEQEADT KSPEFMDRFT GGLIHYSAMF  360
DSLDICFDGS HPQRMPLEED YFGAGIRQIV TFDVEERASL DMKIKDWRAL LNSFNIVEKD  420
LSSSALYQAN IVIENSELSS LCTLSMDGKC LLSGWRGTPI FSLSVWKFIP DIPKLC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-34984678375GRAS family transcription factor containing p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA85001728
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.14e-45RGA-like 1