PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_023350
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 578aa    MW: 64858.8 Da    PI: 5.3794
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_023350genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS262.91.1e-802055732372
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykal.ppsetseknsseelaalkl....fsevsPilkf 93 
                  +++Ll+ Ae v ++++ +a +lL++ +e +s +g+p+qRl+ +f  AL++++ + ++ ++  +  ++++ +    +++l+  +     +++  P+ ++
  DCAR_023350 205 IQQLLASAEKVGEQQFIRAGNLLNHCHEYSSIKGTPVQRLVYHFSAALQQKIDHkTGRRTGTSTgKMQSLA---LKDSLMNPNPslfaYYQKVPFSQV 299
                  799*************************************************9933333333221222222...333333322234559********* PP

         GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledle 190
                    +ta q++ e +++++++HiiD++i +Gl++  L++aLa+R+  +  +l+iT+vg     sk+++e+tg+rL ++A++l+v+f+f+v+++ ++ dl+
  DCAR_023350 300 ILFTAMQTMTENLSKAKKIHIIDLEIRNGLHYTILMEALAARTdCPLEHLKITAVGT---ISKHKIEQTGNRLMSLAQTLNVSFSFDVVIVADMLDLN 394
                  *******************************************45556*********...789*********************************** PP

         GRAS 191 leeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvEre 288
                   + + ++ +E+laV + + l  + ++++ le     ++k++++l+P ++vv+e ea+hns+ F++rf+eal yy a+fds+e  + r++ +r++ E  
  DCAR_023350 395 ESLFMLNAEEKLAVYSPYTLSLMIENQARLET----LMKVIQKLNPCIMVVAEVEANHNSPVFVQRFIEALFYYGAFFDSMEDCMDRDDPDRMMSESI 488
                  ***********************988888888....************************************************************** PP

         GRAS 289 llgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSa 372
                   l+++i+++v  eg+er+ rh + + W++ ++++G+ + +ls+    qakll+ k    +  + e   +sl  gWk+ p++svSa
  DCAR_023350 489 TLSPAITSIVVFEGEERIVRHVNSNVWKAFFSRFGLVETELSTASLYQAKLLVDKSVcANSCTFEMIGKSLSVGWKGTPILSVSA 573
                  *******************************************************999999***********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098539.386178554IPR005202Transcription factor GRAS
PfamPF035143.9E-78205573IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 578 aa     Download sequence    Send to blast
MIGEIFFSKQ QNSRVIPDRY GRSKGYYNME EKNMEIKTRW YGAKESVETG DVNLFHQNNA  60
IEEHLSFPGK QQVLTSSSDF AGFDDLCYDL GASQPQYCLE ELGNLAINHS ENPEHLVPQE  120
TSCQIPISNE SKFGPENCEQ SSLPDHSTTW SNASEKLATK DLLRLAGETF IQSNSAMVDS  180
RSFSNPFTTS LCGLSDEERR DVEIIQQLLA SAEKVGEQQF IRAGNLLNHC HEYSSIKGTP  240
VQRLVYHFSA ALQQKIDHKT GRRTGTSTGK MQSLALKDSL MNPNPSLFAY YQKVPFSQVI  300
LFTAMQTMTE NLSKAKKIHI IDLEIRNGLH YTILMEALAA RTDCPLEHLK ITAVGTISKH  360
KIEQTGNRLM SLAQTLNVSF SFDVVIVADM LDLNESLFML NAEEKLAVYS PYTLSLMIEN  420
QARLETLMKV IQKLNPCIMV VAEVEANHNS PVFVQRFIEA LFYYGAFFDS MEDCMDRDDP  480
DRMMSESITL SPAITSIVVF EGEERIVRHV NSNVWKAFFS RFGLVETELS TASLYQAKLL  540
VDKSVCANSC TFEMIGKSLS VGWKGTPILS VSALKFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-332045754375GRAS family transcription factor containing protein, expressed
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017216815.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLA0A164SK160.0A0A164SK16_DAUCS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA34272149
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.12e-40RGA-like 2