PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_023102
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 496aa    MW: 56871.8 Da    PI: 4.6184
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_023102genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS284.43.2e-87764431364
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  l++lLl  A+ v++++l    + L++l +++  +gd++qR+aayf+ +L arl+   s  y+ +  ++t+    +ee+ a++ +++vsP+++f+h+ta
  DCAR_023102  76 LIHLLLISATSVDENKLDSSVESLSELFQNVCLSGDSIQRVAAYFADGLVARLLTRKSPFYDMIMKEPTA----EEEFLAFTELYKVSPYYQFAHFTA 169
                  689****************************************************99****999888886....788889999*************** PP

         GRAS  99 NqaIleavege.....ervHiiDfdisqGlQWpaLlqaLasRpegpp..slRiTgvgspesgskeeleetgerLakfAeel.gvpfefnvlvakrled 188
                  NqaI ea+e+e     +++H+iDfd+s+G+QWp+L+q+L++++ +++  slRiT++g+    s+eel+et+ rL  fA+ + ++ fef+ l    l  
  DCAR_023102 170 NQAIIEAFEKEegynnNALHVIDFDVSYGFQWPSLIQSLSDKTTNSHriSLRITAFGR----STEELHETETRLVCFAKGFrNLVFEFQGL----LRG 259
                  **********988888899*********************9995544459********....9****************9758*******8....778 PP

         GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvE 286
                   ++++++ +++E+laVnlv++l +l   s s    ++++Lk v  l+P  v++veq+ ++n  sFl+rf+e+l+y++a+fdsl+  lp +s er  +E
  DCAR_023102 260 SSFSNIKRRNNETLAVNLVFHLNTLT--SFSK---ISDTLKSVHFLNPATVILVEQDGSRNPRSFLARFMESLHYFAAMFDSLDDCLPLDSAERLGIE 352
                  889********************998..3333...558************************************************************ PP

         GRAS 287 rellgreivnvvacegae.rrerhetlekWrerleeaGFkpvplsekaakqaklllr........kvk..sdgyrveee.sgslv.lgWkd 364
                  +  lgrei+  +  e++    ++ e++e+W+ r+e  GF+ v+ls+k ++qaklll+        +++  + g+rv e+ +++++ lgW+d
  DCAR_023102 353 KYHLGREIKRFINFEKDVtNCMKYERMETWKGRMEGHGFEGVKLSSKSVMQAKLLLKirsqycpvQCDgeNGGFRVFERdENTAIsLGWQD 443
                  ***************98757899*********************************83333332223332234777654344455699998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098546.7650421IPR005202Transcription factor GRAS
PfamPF035141.1E-8476443IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 496 aa     Download sequence    Send to blast
MEATDHDEEF LNLTLAIDSN SSFDKKRKGM KTEEVLIEPK EECEGKILNL LQLREDMLKL  60
DHKRKGVAED GKGLHLIHLL LISATSVDEN KLDSSVESLS ELFQNVCLSG DSIQRVAAYF  120
ADGLVARLLT RKSPFYDMIM KEPTAEEEFL AFTELYKVSP YYQFAHFTAN QAIIEAFEKE  180
EGYNNNALHV IDFDVSYGFQ WPSLIQSLSD KTTNSHRISL RITAFGRSTE ELHETETRLV  240
CFAKGFRNLV FEFQGLLRGS SFSNIKRRNN ETLAVNLVFH LNTLTSFSKI SDTLKSVHFL  300
NPATVILVEQ DGSRNPRSFL ARFMESLHYF AAMFDSLDDC LPLDSAERLG IEKYHLGREI  360
KRFINFEKDV TNCMKYERME TWKGRMEGHG FEGVKLSSKS VMQAKLLLKI RSQYCPVQCD  420
GENGGFRVFE RDENTAISLG WQDSHPPGQS VAYFTEVFKD YEPADDDYED YEPEHDEPED  480
YGSEYDDLED EKPED*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A8e-458444327369Protein SCARECROW
5b3h_A8e-458444326368Protein SCARECROW
5b3h_D8e-458444326368Protein SCARECROW
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017256072.10.0PREDICTED: scarecrow-like protein 21
TrEMBLA0A164UY490.0A0A164UY49_DAUCS; Uncharacterized protein
STRINGEMJ002090.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA123541823
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04890.11e-51SCARECROW-like 21