PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_022972
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family Nin-like
Protein Properties Length: 909aa    MW: 100720 Da    PI: 6.4441
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_022972genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK924.3e-29592642252
       RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                   k+i+l++l++yF++++kdAAk+Lgvc+T+LKriCRq+GI RWP+Rkik++
  DCAR_022972 592 DKNITLDMLRQYFAGSLKDAAKSLGVCPTTLKRICRQHGITRWPSRKIKKV 642
                  599**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.30.450.401.3E-4214291IPR029016GAF domain-like
PROSITE profilePS5151917.541581662IPR003035RWP-RK domain
PfamPF020421.7E-26594642IPR003035RWP-RK domain
Gene3DG3DSA:3.10.20.2401.2E-21809893No hitNo description
SuperFamilySSF542772.45E-22809896No hitNo description
PROSITE profilePS5174526.802811894IPR000270PB1 domain
SMARTSM006661.9E-23811894IPR000270PB1 domain
PfamPF005641.9E-16812893IPR000270PB1 domain
CDDcd064071.26E-37813893No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 909 aa     Download sequence    Send to blast
MGDASFPPNN NMLYTSPDPV MDLDLDELLF DGCWLEANDG SEFFNQSPPP FDPSFLWSSM  60
ENYNGDFNWT SVPKDSQEER QRSSYPGNLS ISQPPNQIQG LGNDMLTSTS HIGNYSVEGS  120
QLGSNLWIGP RPIHGRAMSV MDRVVRALEY FKSSTRDTDV LLQLWVPIDR GGRRVLSTCG  180
QPFSLDSNSP RLANYRAISV KYQFSAEHDS KEVEGMPSRV FMGKVPEWTP DVRFYKREEY  240
QRVRHAQQYD VRGTLAVPVF EQGTCLGVIE IVTTSQKINY KPELESVCEA LKAVDLRGSE  300
VASTHSMKIC NGSYQSALPE IMEVLRCTCE TNRLPLAQTW IPCVQQGKEG CRHSDENIIN  360
CVSTLDSACY IAEPSIRGFH EACSEHHLLR GQGVVGKAFM SNQPSFSPDV TSDSKTEYPL  420
SHHARMFGLC AAVAIRLRSI YTGTSDFVLE FFLPVNCRDP EDQKILLNAL SIVIQKVCHS  480
LRIVTDTELH EETLMRAGKA VVPSADRLGK QEIAEVENSA KSSHEVSFRT SSNMEMQESK  540
PRELTESASS PSQYQQISAD GHVTFNQDLC ASGRGSYSSV GKTGEKRRGK TDKNITLDML  600
RQYFAGSLKD AAKSLGVCPT TLKRICRQHG ITRWPSRKIK KVGHSLQKIQ GVIDSVQGAS  660
GGFQIKSFYS NFPELASPNS SKHILLTASK PIGNSSQNEG SALSPEAVAS KSPPSSCSQS  720
SNSSHCYSSG TQAQPCNLNG LNNEDQVGCN PGEGILKRAT SAVHLHASTH DVPKVLSRSQ  780
SYKNLIRQPR TESPSRLPND IGENIPEGDS TSRVKVTYGE EKIRFRMLNS MTYDDLLVEI  840
TKRFCIDDRT GFHLKYLDDD SEWVLLTCDD DLEECREVCE SAHSQTIKLS LHQNPTQHLG  900
SSYGSSQL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00154DAPTransfer from AT1G20640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017258329.10.0PREDICTED: protein NLP5-like
RefseqXP_017258330.10.0PREDICTED: protein NLP5-like
TrEMBLA0A164V1550.0A0A164V155_DAUCS; Uncharacterized protein
STRINGevm.model.supercontig_26.1860.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15982467
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein