PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_022924
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family bZIP
Protein Properties Length: 570aa    MW: 62169.6 Da    PI: 6.5266
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_022924genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.54.3e-11415473563
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                  kr++r   NR +A rs +RK  +i eLe kv++L++e ++L  +l  l+  +a l++++
  DCAR_022924 415 KRAKRILANRQSAARSKERKMRYISELEHKVQTLQTEATTLSAQLTLLQRDSAGLTNHN 473
                  9************************************************9999998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.7E-17411475IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.749413476IPR004827Basic-leucine zipper domain
PfamPF001702.5E-9415470IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.9E-11415470No hitNo description
SuperFamilySSF579592.95E-11415466No hitNo description
CDDcd147031.25E-24416467No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 570 aa     Download sequence    Send to blast
MGDSEEGNTD MMHILQSSFG NSSSAPKLSH SVNQLDIPQF NNSQLRAQMR QFSPSFGGES  60
NKRVGIPPSH PQMPPISPYS QIPGTRSGNQ QMGPGNFGQG SGVSHTRSLS QPSFFPLDSL  120
PPLSPSPYRD SSVTPVSDIV SPDVSMEDRD GNLHSPFSKG NSLRVGESLP PRKAHRRSNS  180
DIPFGFSTIM QTSPPLIPLR SSAERAASTR DSMGLKPVQL VKREECWDKG IGDSNAEGMG  240
ERKSGEVVDD LFSAYMNLDK LEALNSSETG DKQGTENRED IDSKVSGTKT NGDSSDNEAT  300
SSINESGNSM QRPGISSSAD KKEGLKRNAG GDIAPTSRHY RSISMDSFMG SMNFGDESPK  360
LPPSPGQRAG QLSPSNSIDE NTFSLEFGNG EFSGAELKKI MANEKLSEIA LSDPKRAKRI  420
LANRQSAARS KERKMRYISE LEHKVQTLQT EATTLSAQLT LLQRDSAGLT NHNNELKFRL  480
QAMEQQAQLR DALNEALTAE VQRLKIATAD MGGEAAKFQQ LSLNSQMYQM HQQQQQQQSS  540
QLNMHQMQQQ AQQSQSQQNE STNSKHESG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017258271.10.0PREDICTED: uncharacterized protein LOC108227565
TrEMBLA0A161XAS80.0A0A161XAS8_DAUCS; Uncharacterized protein
STRINGVIT_03s0038g00860.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12652478
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-140bZIP family protein