PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_022479
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family NAC
Protein Properties Length: 316aa    MW: 35638 Da    PI: 8.8647
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_022479genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.12.9e-52141391128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  lp+GfrF Ptdeel+v+yL++kv+g++++l ++i+e+++yk++Pw Lp+k+  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg+dk ++s +g+
  DCAR_022479  14 LPAGFRFYPTDEELMVQYLCRKVAGQHFSL-QIIAEINLYKFDPWVLPSKAMFGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGTDKIIMS-EGR 109
                  799**************************9.89***************8777899***************************************.999 PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                  +vg+kk Lvfy g+apkg+kt+W+mheyrl
  DCAR_022479 110 KVGIKKALVFYIGKAPKGTKTNWIMHEYRL 139
                  ****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-669163IPR003441NAC domain
PROSITE profilePS5100559.53114162IPR003441NAC domain
PfamPF023651.3E-2515139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MGVQQTDPLS QLNLPAGFRF YPTDEELMVQ YLCRKVAGQH FSLQIIAEIN LYKFDPWVLP  60
SKAMFGEKEW YFFSPRDRKY PNGSRPNRVA GSGYWKATGT DKIIMSEGRK VGIKKALVFY  120
IGKAPKGTKT NWIMHEYRLS EPQRRNGSSK LDDWVLCRIY KKNSSAQKTL AATNASTEHS  180
HSHGSSSSCS SQFDDVMESL PQIDERFVDL PRMNSLNDWA AIAEQLAGAP VGNQTQALSS  240
NNNNNQNDLY FPCNLISRPG GFEARFKTSI EEEVESGFKN QTSEFMSFNG YSQCFGNDRL  300
AIRYPNLPGN VGFRQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-11111687174NAC domain-containing protein 19
3swm_B1e-11111687174NAC domain-containing protein 19
3swm_C1e-11111687174NAC domain-containing protein 19
3swm_D1e-11111687174NAC domain-containing protein 19
3swp_A1e-11111687174NAC domain-containing protein 19
3swp_B1e-11111687174NAC domain-containing protein 19
3swp_C1e-11111687174NAC domain-containing protein 19
3swp_D1e-11111687174NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in abscisic acid-mediated stomatal closure (PubMed:25005917). Regulates the expression of NCED1, a gene involved in the biosynthesis of abscisic acid (ABA) (PubMed:25005917). Required for the stomatal closure induced by the bacterial pathogen Pseudomonas syringae pv tomato DC3000, but not for stomatal reopening (PubMed:25005917). {ECO:0000269|PubMed:25005917}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by abscisic acid (ABA), dehydration and wounding. {ECO:0000269|PubMed:25005917}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU5651841e-150GU565184.1 Apium graveolens NAC transcription factor (NAC) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017254745.10.0PREDICTED: NAC domain-containing protein 72-like
SwissprotQ9SQL01e-128JA2_SOLLC; NAC domain-containing protein JA2
TrEMBLA0A164VCW80.0A0A164VCW8_DAUCS; Uncharacterized protein
STRINGXP_006451940.11e-135(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31222452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.21e-117NAC family protein
Publications ? help Back to Top
  1. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]