PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_022065
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family G2-like
Protein Properties Length: 400aa    MW: 44799.7 Da    PI: 9.2345
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_022065genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.88.9e-32269324156
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                  k+r++W+peLH+rFv a+++LGG+++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  DCAR_022065 269 KQRRCWSPELHRRFVGALQELGGAHVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 324
                  79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.864266326IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.7E-28266327IPR009057Homeodomain-like
SuperFamilySSF466892.45E-16266326IPR009057Homeodomain-like
TIGRFAMsTIGR015574.2E-26269324IPR006447Myb domain, plants
PfamPF002491.1E-6271322IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 400 aa     Download sequence    Send to blast
MVLNTQELNL NIKPTFVPKT IADFIGEVST IRNVSEKLVK LDGFIKRLED EMRKIDAFKR  60
ELPISMLLIS DAIAALKEEL IQCRRRNVEP VFEEFIPLKK TCDEAEKDEK TRMEKECKEK  120
KNWMSSVQLW NNTDDEKKQD TDSDSNRKPN SVVEIAKKSN PENDAKMTDV FQKDVYQSYK  180
GRAEASAFMP FKGYLAIPEA AVRKEAKVED KNEFSVAGLS LVTPGTSKPR LELGSSVLSS  240
KSSSSIAVSY SSPNIQSKLQ TSSSQTSRKQ RRCWSPELHR RFVGALQELG GAHVATPKQI  300
RELMQVDGLT NDEVKSHLQK YRLHDRRSPT SKSADSALTL GSALMFSGNG ESSTKPRSKS  360
TSPEGPLQLT DTAVRTSTTV SDSMEDEEAE RSKSYSWKK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002284970.21e-134PREDICTED: myb family transcription factor EFM isoform X2
TrEMBLA0A161ZUT30.0A0A161ZUT3_DAUCS; Uncharacterized protein
STRINGVIT_03s0063g01060.t011e-133(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43612443
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.15e-48G2-like family protein