PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_021275
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family LBD
Protein Properties Length: 336aa    MW: 37039.5 Da    PI: 7.4608
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_021275genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26098.37.8e-3111100291
       DUF260   2 CaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                  Ca+C+++ +kC+++Cvlapy+  +++ +f++vhk+FG+ nv k++k+l+ e+r +a++slv+eA++r++dPv G++g +++l+++l++ +
  DCAR_021275  11 CASCRHQHKKCNESCVLAPYLTLDKNLEFQAVHKVFGVGNVAKIVKSLDVEDRGRAVESLVWEANCRQNDPVLGSYGEFMRLSEELNKYR 100
                  ************************************************************************************999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089119.6189110IPR004883Lateral organ boundaries, LOB
PfamPF031956.5E-301199IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MQRDNGPPAG CASCRHQHKK CNESCVLAPY LTLDKNLEFQ AVHKVFGVGN VAKIVKSLDV  60
EDRGRAVESL VWEANCRQND PVLGSYGEFM RLSEELNKYR TLYWNNIHAQ GNMSMNMNAN  120
VSVAVLPANS YAGYGYPTMQ SAGALRGEIG YPTMQSAGAL RGEIGYPTMQ SAGALRGEIG  180
YDYPYVQGTD GFKEESNRSA LSLPLQYGVQ INENLKDGSN DGSVIVPQRY STRGAVVASS  240
DITIHELLLS SNEFTGSDHV DNSITASPQL QRIPNKDPAR KGHKWQYFNI YRSKVYFKCL  300
AFGIQMTRLF YTKSALTFDW DNSVGCSSAS NNEFV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A9e-16910110109LOB family transfactor Ramosa2.1
5ly0_B9e-16910110109LOB family transfactor Ramosa2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017257543.11e-175PREDICTED: LOB domain-containing protein 2-like
TrEMBLA0A161ZWG10.0A0A161ZWG1_DAUCS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA101771827
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.16e-35LOB domain-containing protein 2