PlantRegMap
Plant Transcription Factor Database
PlantTFDB
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_021107
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 544aa    MW: 61399.7 Da    PI: 6.7526
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_021107genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS455.33.9e-1391745432374
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                  +++L++cA+avs++dl  aq+l+a+l+ ++s +g+p+qRl ay++e+L arla+s+s +yk+l+++e +   sse l+++++++ev+P+lkf+++ aN
  DCAR_021107 174 KQVLVACARAVSDNDLLTAQWLMAELRLMVSVSGEPIQRLGAYLLEGLVARLASSGSLIYKSLRCTEPE---SSELLSYMHVLYEVCPYLKFGYMSAN 268
                  799*****************************************************************9...9************************* PP

         GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLr 195
                   aI ea++ e+ vHiiDf+i+qG QW++L+qa+a+R++gpp++RiTg+++++s   +   l+ +g+rL+++A++++vpfef++ ++ + +++++e+L+
  DCAR_021107 269 GAIAEAMKDENSVHIIDFQIGQGSQWITLIQAFAARRGGPPHIRITGIDDSTSAyaRGGGLNIVGKRLSRLARSFKVPFEFHA-AVMSGSEVQPESLE 365
                  **************************************************998899999************************.8999********** PP

         GRAS 196 vkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgre 293
                  ++ gEalaVn++++lh+++desvs++++rd +L++vk+l+Pkvv++veqe+++n++ F+ rfle+++yysa+f+s+ea+lpre++eri+vE+++l+r+
  DCAR_021107 366 IHYGEALAVNFAFMLHHMPDESVSTQNHRDGLLRFVKRLNPKVVTLVEQESNTNTAAFFPRFLETMDYYSAMFESIEATLPREHKERINVEQHCLARD 463
                  ************************************************************************************************** PP

         GRAS 294 ivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  +vn++aceg+er+erhe ++kW++r+++aGF+p+pls+ +++++k+ll ++ +  yr+ee++g+l+lgW++r Lv+ +aW+
  DCAR_021107 464 VVNIIACEGTERVERHELMGKWKSRFKMAGFTPYPLSSLVNATIKRLLDNYCD-KYRLEEREGALYLGWMNRDLVASCAWK 543
                  ***************************************************95.5*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098569.082147524IPR005202Transcription factor GRAS
PfamPF035141.3E-136174543IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0005737Cellular Componentcytoplasm
GO:0004871Molecular Functionsignal transducer activity
Sequence ? help Back to Top
Protein Sequence    Length: 544 aa     Download sequence    Send to blast
MLVSSMQASR RRRSSLSNTL YYPSTQGVEH CLFPKSQSLD KQLHYSNSIP GIKTERYCTL  60
ESSLATDNFG SLHNSTTAVT YSQSESSMSQ QESQSYLHDH NYGSPMSVSC LTDDTTELRQ  120
KANTNDFKHK LKELETLMLG PDSNFLDSLN CNLASPETDN WKRMFEEIPR RDMKQVLVAC  180
ARAVSDNDLL TAQWLMAELR LMVSVSGEPI QRLGAYLLEG LVARLASSGS LIYKSLRCTE  240
PESSELLSYM HVLYEVCPYL KFGYMSANGA IAEAMKDENS VHIIDFQIGQ GSQWITLIQA  300
FAARRGGPPH IRITGIDDST SAYARGGGLN IVGKRLSRLA RSFKVPFEFH AAVMSGSEVQ  360
PESLEIHYGE ALAVNFAFML HHMPDESVST QNHRDGLLRF VKRLNPKVVT LVEQESNTNT  420
AAFFPRFLET MDYYSAMFES IEATLPREHK ERINVEQHCL ARDVVNIIAC EGTERVERHE  480
LMGKWKSRFK MAGFTPYPLS SLVNATIKRL LDNYCDKYRL EEREGALYLG WMNRDLVASC  540
AWK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A1e-5818054226378Protein SCARECROW
5b3h_A1e-5818054225377Protein SCARECROW
5b3h_D1e-5818054225377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in phytochrome A (phyA) signal transduction. {ECO:0000269|PubMed:10817761}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017214888.10.0PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_017214890.10.0PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_017214891.10.0PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_017214892.10.0PREDICTED: scarecrow-like transcription factor PAT1
SwissprotQ9LDL70.0PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLA0A164WAS60.0A0A164WAS6_DAUCS; Uncharacterized protein
STRINGVIT_12s0057g00560.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68124111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Heyman J, et al.
    The heterodimeric transcription factor complex ERF115-PAT1 grants regeneration competence.
    Nat Plants, 2016. 2(11): p. 16165
    [PMID:27797356]