PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_020944
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family G2-like
Protein Properties Length: 316aa    MW: 34620.9 Da    PI: 7.1893
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_020944genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.45.9e-32120173255
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  pr+rWt++LH++Fv+av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  DCAR_020944 120 PRMRWTSTLHAHFVHAVQLLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 173
                  9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-28118174IPR009057Homeodomain-like
SuperFamilySSF466892.51E-15118174IPR009057Homeodomain-like
TIGRFAMsTIGR015577.2E-24120173IPR006447Myb domain, plants
PfamPF002495.1E-7121172IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0080060Biological Processintegument development
GO:0005618Cellular Componentcell wall
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MTSAATASTV PDLSLQISPP SPLAKDHIGL MVRESAYSDR SSATDSGSSG GSDLSHENET  60
KAFCDNLDLS LGLEMLGPNM NSPRPLQDNV RHYKPRICSR EFRGGSRTMS IGMKRSARAP  120
RMRWTSTLHA HFVHAVQLLG GHERATPKSV LELMNVKDLT LAHVKSHLQM YRTVKSTDKV  180
TGQGQTEMDL NQRKHIGEGE VEACDNLPSN SINPSLPSLS IPTKLQKLQS LSRDSLASLS  240
ETNERGHSHQ ENSSSTYLAS QEDDNKVKEN EEVDAMHQLE KEKMLLNLEI SLGRPIWQSN  300
GSSSGLISLL NCVRP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A8e-17121175458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B8e-17121175458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A8e-17121175357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B8e-17121175357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C8e-17121175357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D8e-17121175357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A8e-17121175458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C8e-17121175458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D8e-17121175458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F8e-17121175458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H8e-17121175458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J8e-17121175458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00107PBMTransfer from AT5G42630Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017257205.10.0PREDICTED: probable transcription factor KAN4
TrEMBLA0A164WEX60.0A0A164WEX6_DAUCS; Uncharacterized protein
STRINGcassava4.1_011255m2e-76(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA122621822
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.14e-51G2-like family protein