PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_020756
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family bZIP
Protein Properties Length: 402aa    MW: 43750.7 Da    PI: 5.7767
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_020756genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1445e-14319365551
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                  kr++r++kNRe+A rsR++K a++ eLe ++k +++eN  L++el e
  DCAR_020756 319 KRQKRMMKNRESAARSRAKKHAYTIELEAEIKYMKNENFNLRQELAE 365
                  9*****************************************88865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.6E-10314376IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.289317365IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.81E-10319365No hitNo description
PfamPF001703.1E-12319365IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1709.4E-13319365No hitNo description
CDDcd147072.80E-18319365No hitNo description
PROSITE patternPS000360322337IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MSYQQEQNPG GETPTKNPGM EVMAGQSENE VESALRMEDG EQPRSNAFPS FSRPSSVYLL  60
TLDEFHNTLR GSGRNYGSIN MDEFLQSIWT AEENQVQAQN AAITVPAVPH MTIVNNINPQ  120
NPSFESSNGR GSTARNLSLT GQGSLSVPAP LSQRTVEEVL SEINRTEQNT NNITHAGSKQ  180
SGPTYGEMTL EDFLVRAGVV PEESARPSQP PSAFPPSPPP PPQLPQLQPQ PQSQLLYGMF  240
VNCDTALASS FMTVGCGGAG SENVPPPFNT VTQIGGLNVS DNGCGTESFE QMSHVSSNGI  300
GMSTPRSKLN GLVERVIEKR QKRMMKNRES AARSRAKKHA YTIELEAEIK YMKNENFNLR  360
QELAESFTRS TQQNTDAAKP KDQAKGKDKL GLLRRCPSSP F*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017255722.10.0PREDICTED: protein ABSCISIC ACID-INSENSITIVE 5-like isoform X1
TrEMBLA0A161YFX50.0A0A161YFX5_DAUCS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61552433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36270.15e-52bZIP family protein