PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_020616
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family bZIP
Protein Properties Length: 345aa    MW: 38589.5 Da    PI: 8.4502
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_020616genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.91.3e-14256298547
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 
                  +r++r++kNRe+A rsR+RK+a++ eLe+kv+ Le+eN++L+ 
  DCAR_020616 256 RRQKRMIKNRESAARSRARKQAYTHELENKVQRLEEENERLRR 298
                  79***************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.6E-11252305IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.794254299IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.0E-14256299No hitNo description
PfamPF001702.9E-12256298IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.75E-12256300No hitNo description
CDDcd147071.04E-24256301No hitNo description
PROSITE patternPS000360259274IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MGSQGSYGSG GSREMQESGK DFLAQQNSLY NLTLDEVQSQ LGHLGKPLTS MNLDEFLKSV  60
WTVEANQGLG RVDYGASQNG LLASGSGLYR QSSVTLPRDL SKKTVDEVWK DIQQGQNKNS  120
TRMSNRERNS TFGEMTVEDF LVKAGVVTEG GKASGPVFGV EPVALPQQSS PQTPWLNYQI  180
PSTHQPTQQQ NMLSVFMPGN IVQPSLSLSS NTILDVYNET QMTISPSPLM GTLSDTQTPG  240
RKRNASGDVV EKTVERRQKR MIKNRESAAR SRARKQAYTH ELENKVQRLE EENERLRRQK  300
VIFSIVHCCM FSYCIFNKYF HLTSGVTFPY ICMCENFFML DNHV*
Functional Description ? help Back to Top
Source Description
UniProtBinds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter. Could participate in abscisic acid-regulated gene expression during seed development.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00409DAPTransfer from AT3G56850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017254788.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
RefseqXP_017254789.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
SwissprotQ9LES35e-89AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLA0A161YG900.0A0A161YG90_DAUCS; Uncharacterized protein
STRINGPGSC0003DMT4000722601e-118(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA33342448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.14e-82ABA-responsive element binding protein 3
Publications ? help Back to Top
  1. Kim H, et al.
    ABA-HYPERSENSITIVE BTB/POZ PROTEIN 1 functions as a negative regulator in ABA-mediated inhibition of germination in Arabidopsis.
    Plant Mol. Biol., 2016. 90(3): p. 303-15
    [PMID:26667153]
  2. Song C,Kim T,Chung WS,Lim CO
    The Arabidopsis Phytocystatin AtCYS5 Enhances Seed Germination and Seedling Growth under Heat Stress Conditions.
    Mol. Cells, 2017. 40(8): p. 577-586
    [PMID:28756655]