PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_020597
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family bZIP
Protein Properties Length: 691aa    MW: 75762.6 Da    PI: 6.9884
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_020597genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_138.52.5e-12186246262
                  XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                  ++ k+  r+++NRe+A  sRq+Kk++ieeLe+kv ++ +  ++L  +++    e  +lk++
  DCAR_020597 186 EDEKKKARLIRNRESAHLSRQKKKQYIEELEDKVRAMHSTIQDLNARISYFVAENNTLKQQ 246
                  5679999****************************************99999999999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.0E-16185249IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.059187247IPR004827Basic-leucine zipper domain
PfamPF001701.2E-10188247IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.2E-15189248No hitNo description
SuperFamilySSF579591.38E-11189247No hitNo description
CDDcd147043.03E-19190240No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 691 aa     Download sequence    Send to blast
MADPAFDDPI PNLDTLPIPD DPFLSDDLAF SDHYYDDVLN FNLDDLDLDN LLNSINPSSN  60
SIQPDSFHDD ANHLDFSSSD VVVDISGGKS SDNSKCLNNP SSENSNSRDF CQEFGNNDFG  120
GSGPVSSQGS DDCVRSFDNS PASGNRVVDH KRKKEEEEGN SVIRTIKSRR SNEVTDRLKS  180
NEGDDEDEKK KARLIRNRES AHLSRQKKKQ YIEELEDKVR AMHSTIQDLN ARISYFVAEN  240
NTLKQQMNCG SIGPQPMGMY PTPAMAPMGF PWAPYPPYYM KPQGSQVPLV PIPRLKPKVQ  300
HDKISKNGES KRKEGRSKTK KVASVSFLGF LFFILLFGGL VPMVSVKHGG LTGMWLGRSD  360
YEENRFGQEH HVGKVLVVNG TDHDSGTRFS GKNLDNGNMK NYDSNFDCHR GHFGAARANM  420
KQTSSEDFAP SGNVSDRLVA SLYVPRNDKL VKIDGNLIIH SVLASEKAKL SNEDGQTKNG  480
KNSLAVPSSL APAISYPGGQ NIENLPHLYR STAGHKVLPS GKDDPNSAPR NGELQQWFLE  540
GLGGPVLRSG MCTEVFQFDV SPTPGSITPA NSVRNVSVEE KRNSTHLNKG QNRKILRGLP  600
IPLPGSANNI SEESGRSNSK KDKSNRNSTY SPMIVSVLVD PREAGDFGAD GMLGTKPLSR  660
IFVVVLLDSV KYVTYSCMLP FKGSNMLGTA *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017258074.10.0PREDICTED: bZIP transcription factor 17-like
TrEMBLA0A164WNR30.0A0A164WNR3_DAUCS; Uncharacterized protein
STRINGVIT_08s0040g00870.t011e-161(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA30292450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.11e-133bZIP family protein