PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_020413
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family G2-like
Protein Properties Length: 374aa    MW: 42346.9 Da    PI: 8.3258
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_020413genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.74.6e-32190243255
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  DCAR_020413 190 PRMRWTTSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLSHVKSHLQMYRT 243
                  9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-28187243IPR009057Homeodomain-like
SuperFamilySSF466892.51E-15187243IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-23190244IPR006447Myb domain, plants
PfamPF002491.8E-7191242IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0048481Biological Processplant ovule development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MELFPAQPDL SLQISPPNTK NNTPSFWRTP LDHHTSKISA LSCKPESTDI AFELSLLPHH  60
QYHNTEKPSL SQPHHHNNNN HNPTNFHHAP PHLFQYKQNG NFGPHHQIQE LPQGFHQQYQ  120
IQETQQGFRQ EIDYLRPIRG IPVYQTQKPT PSSFLSAPQQ QQHYSSLDSS NISRSKFLSR  180
FPTKRSTRAP RMRWTTSLHA RFVHAVELLG GHERATPKSV LELMDVKDLT LSHVKSHLQM  240
YRTIRTTDRP ANSSDGFESD LVVDNSEDQA GDVQILGEAS GASSVKRTRP VAIEQDHDSY  300
GLWSNSSSRD AGIRGKPIRS TTGHPSPPFE ELLSYENTFE KPLNSAPAVE MRSKKPNLDF  360
SLGRSYNDHH ISC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A9e-17191245458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B9e-17191245458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A9e-17191245458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C9e-17191245458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D9e-17191245458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F9e-17191245458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H9e-17191245458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J9e-17191245458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates lateral organ polarity. Promotes abaxial cell fate during lateral organd formation. Functions with KAN1 in the specification of polarity of the ovule outer integument. {ECO:0000269|PubMed:11525739, ECO:0000269|PubMed:15286295, ECO:0000269|PubMed:16623911, ECO:0000269|PubMed:17307928}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00174DAPTransfer from AT1G32240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017254655.10.0PREDICTED: probable transcription factor KAN2
SwissprotQ9C6162e-48KAN2_ARATH; Probable transcription factor KAN2
TrEMBLA0A161ZVU90.0A0A161ZVU9_DAUCS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27382255
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.11e-50G2-like family protein
Publications ? help Back to Top
  1. Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
    The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis.
    Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71
    [PMID:26108442]