PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_020360
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRF
Protein Properties Length: 420aa    MW: 45822.5 Da    PI: 5.4333
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_020360genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.91e-2486130145
          WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                  d+epgrC+RtDGKkWRCsr+v + +k+CErH+hrgr rsrk++e+
  DCAR_020360  86 DPEPGRCKRTDGKKWRCSRDVAPQQKYCERHMHRGRPRSRKPVEP 130
                  79****************************************997 PP

2QLQ54.14.6e-192555232
          QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLl 32
                 aFT aQ+ +L++Q+++yKy++a++PvPp+Ll
  DCAR_020360 25 AFTRAQWKELERQAMIYKYMVASVPVPPQLL 55
                 8*****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.3E-102460IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.6E-132555IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166619.6762560IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.3186130IPR014977WRC domain
PfamPF088792.5E-2087129IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MVAFAGGIVG MATTAAYPPH TEAPAFTRAQ WKELERQAMI YKYMVASVPV PPQLLSSDFS  60
APTTPMGLGP LGYASIFNLK YGDNKDPEPG RCKRTDGKKW RCSRDVAPQQ KYCERHMHRG  120
RPRSRKPVEP QHQQQVSSSP KSNKKTRLVS AAPPPPGSPG LLGSTNELGN NSPSPLLLKT  180
VSKVEEDMEW MMESKMMTME TSEQQWHQMM SQGSVYNTSP TDPSIFQHNN YGVEEQQLGL  240
LSLPQIGDSS TDDYNLFMNS YNPPRDFIDA WSTDNNPNSE TIKNDATCGV NNMNLSPCSL  300
NLSMAMGVND CEMGQIQMLE EGNEPSQKCN GLSWLSPVSW NASAPGGPLA EVLRPSNVIV  360
NSNPGSPCAE KNCDTISPQE TSPSGVLHRT MLSLSDNSVC NSPTVAAAAP EFVGFQWLN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU7355329e-35EU735532.1 Gossypium arboreum small heat shock protein gene, promoter region and partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017255638.10.0PREDICTED: growth-regulating factor 7-like isoform X2
TrEMBLA0A164WUN80.0A0A164WUN8_DAUCS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA70322230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.12e-36growth-regulating factor 2