PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_020332
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family Nin-like
Protein Properties Length: 374aa    MW: 42529.9 Da    PI: 5.6387
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_020332genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK83.71.7e-26252302252
       RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                  ++ ++l++++kyF+lpi++AAkeL+v+lTvLK++CR+++I+RWPhRkiksl
  DCAR_020332 252 TSALELDEIRKYFNLPITKAAKELNVGLTVLKKRCRELNIRRWPHRKIKSL 302
                  67899********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.564238322IPR003035RWP-RK domain
PfamPF020421.6E-22255302IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MNSTVKVELN HNDDYLPGFS YLNDQESGGF IYNGGSIIGE FDPFLEPWPL SVQYDDDIPE  60
LSMKDIEEIT RSLDADYSSI YQAGNSTLDG ATQPTMMATQ PQIELSTNLV DANQKIETTQ  120
SDQYLHAQNM CLDAVPVYST ITHHEAQYFN NYNVGSLGNS ENVVYDSMHF KDDYRDIFPL  180
QIDESVMLDA EPIRMIPASS NHVPQCHNVS VAHDSGNVKN AMNLKSEQSS NMTAMVKYEE  240
GVSFRPNIRC KTSALELDEI RKYFNLPITK AAKELNVGLT VLKKRCRELN IRRWPHRKIK  300
SLQSLINNVR EMGLTNKREI EMLEENQRML ERVPELELSE STKRLRQSCF KANYKKRRML  360
LSAAAAGRHS GRL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012471149.13e-58PREDICTED: protein RKD4
TrEMBLA0A164WV860.0A0A164WV86_DAUCS; Uncharacterized protein
STRINGGorai.003G121600.11e-57(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA121431922
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.12e-40RWP-RK domain-containing protein