PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_020327
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family Nin-like
Protein Properties Length: 384aa    MW: 43514.9 Da    PI: 6.2753
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_020327genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK826.1e-26267317252
       RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                  ++ ++l++++k+F+lp+++AAk+L+v++TvLK++CR+++IkRWPhRkiksl
  DCAR_020327 267 TSALELDEIRKHFNLPLTEAAKKLNVGPTVLKKRCRELNIKRWPHRKIKSL 317
                  67899********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.336253337IPR003035RWP-RK domain
PfamPF020422.9E-23270317IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MNSIVKVEFD NHDDQETTGG FIDNYSIYNG GSRIEEFDPM CEPWPLSGQH DDIPELSMKD  60
IEEITRSLDA DCSCLFHQPG NSTLVGATQP TVMASQPQIY NEPSPLVDAN TKIETTQSHQ  120
YFHAQNMFVD AVSVYATITH HEAQDFPTHY RRADYETTNQ PQYSNNYNVG NLGSSENVVY  180
NSMHLKDDYC DIFPLQIDEN VIVDAEPICM IPASANHVPQ CHNVSAAHDS GNVKSAINLK  240
SEQSSNVTAM VKYEEGVSLR QNARCKTSAL ELDEIRKHFN LPLTEAAKKL NVGPTVLKKR  300
CRELNIKRWP HRKIKSLQCL INNIKEMGMT NKKEIEMLEE SQRMLERVPE LELSESAKRL  360
RQSCFKANYK KRRLSRSSAA ARR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A164WVD20.0A0A164WVD2_DAUCS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA121431922
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.17e-35RWP-RK domain-containing protein