PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_020110
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family CO-like
Protein Properties Length: 347aa    MW: 38095.1 Da    PI: 6.9323
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_020110genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box284.4e-091858341
     zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg..Htvvp 41
                 +r C+ ++   + lfC ++++++C  C +++H++  H++v+
  DCAR_020110 18 ARPCDVCKTAAALLFCITDSSYMCMGCDSKIHSNtiHERVS 58
                 689******99*********************889**9987 PP

2zf-B_box28.33.7e-0957102342
     zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                    +C+ +e+ +++  C+ +   lC  C + +H+       H++vp+
  DCAR_020110  57 VSMCEVCEQAPASVTCKADAAALCVRCDMDIHSAnplsrrHERVPV 102
                  578*****************************66899999*99986 PP

3CCT69.58.4e-24272316145
          CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45 
                  Rea+++RY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++e
  DCAR_020110 272 REARVMRYREKRKNRKFEKTIRYASRKAYAEKRPRIKGRFAKRSE 316
                  9*****************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003364.4E-41659IPR000315B-box-type zinc finger
PROSITE profilePS501199.1721659IPR000315B-box-type zinc finger
PfamPF006436.5E-71758IPR000315B-box-type zinc finger
CDDcd000217.66E-61959No hitNo description
PROSITE profilePS5011911.06455102IPR000315B-box-type zinc finger
PfamPF006434.6E-757102IPR000315B-box-type zinc finger
CDDcd000218.77E-1059102No hitNo description
SMARTSM003363.8E-1060102IPR000315B-box-type zinc finger
PROSITE profilePS5101716.916272314IPR010402CCT domain
PfamPF062035.4E-18272314IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MSELVGVKCS PMRWAAKARP CDVCKTAAAL LFCITDSSYM CMGCDSKIHS NTIHERVSMC  60
EVCEQAPASV TCKADAAALC VRCDMDIHSA NPLSRRHERV PVALFGLAVA VKSPETPTLE  120
VPIIREDVNL FGSNDCKISA DMKSIELLFT DPDNLLEFDY PDQNNLSSLY SNSNPSADSV  180
VPVQFISKPA QPLPQSADNH FEIDFTTSNI GSFGTSYTAP SISQNISTEV GVVPDGSCMS  240
EISYQCGLAM NNSVITNSST NGNVQVLVGM DREARVMRYR EKRKNRKFEK TIRYASRKAY  300
AEKRPRIKGR FAKRSENTED ASRWLSSSQA RTNFVEDSGF GVVPSF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017255010.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 5
SwissprotQ9FHH81e-92COL5_ARATH; Zinc finger protein CONSTANS-LIKE 5
TrEMBLA0A164X0F00.0A0A164X0F0_DAUCS; Uncharacterized protein
STRINGVIT_11s0052g01800.t012e-96(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.12e-92CONSTANS-like 5
Publications ? help Back to Top
  1. Vercruyssen L, et al.
    ANGUSTIFOLIA3 binds to SWI/SNF chromatin remodeling complexes to regulate transcription during Arabidopsis leaf development.
    Plant Cell, 2014. 26(1): p. 210-29
    [PMID:24443518]