PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_019917
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 519aa    MW: 58861.6 Da    PI: 4.3769
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_019917genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS329.37.4e-1011435111374
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykal.ppsetsekn...sseelaalklfsevsPilkfs 94 
                  lv+lLl+cAeav  +d+  a+a+L+++ + +sp gd++qR+a +f+ +L arl+   +++ +     + + +++    +e+l a+ l+++++P++ f+
  DCAR_019917 143 LVHLLLACAEAVGCRDTLHARAMLSQIWTCVSPWGDSLQRVAYCFAMGLDARLSL-LNHVKANGiLENGSGDQSlitKEERLEAFYLLHQTTPYISFG 239
                  68***************************************************98.3333332212232322335779999***************** PP

         GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvl.vakrledle 190
                  +++aN aI ea+eg++ +Hi+D+++++ lQWp L ++La+R +gpp  +RiTg+++       +  ++++ +   Ae+lg++++f  +  a + + l+
  DCAR_019917 240 FMAANDAICEAAEGKDFLHIVDLGMEHTLQWPHLVRKLAARLGGPPkLIRITGIND----LCVKEYQMQDTI-VEAESLGISVKFCRIdEAVTESLLT 332
                  ******************************************9999678*******....444445566655.57************9545577889* PP

         GRAS 191 leeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvEre 288
                   e+L++++gEal Vn+ +qlh+ ++es  + +    +L+++k+l+P++++vveq+a++n++ Fl rfle+l+yysa+fdsle++lpr+s er+k+E+ 
  DCAR_019917 333 KENLDIREGEALFVNSLMQLHKYVKESRGSLK---IILQAIKKLEPTLLTVVEQDANLNGPFFLGRFLESLHYYSAVFDSLESSLPRNSIERMKIEKL 427
                  ***********************987765555...7************************************************************** PP

         GRAS 289 llgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  ++++ei+n+va ega+r++r  ++ +Wr++l++aGF++v +++ + ++ +  ++ ++sdgy++  ++++l+lgW++rp++ +SaWr
  DCAR_019917 428 YFAEEIRNIVAYEGADRIQRYDRADQWRRQLSRAGFQSVGFRNPNLTNLS--VSLCQSDGYTLATDKNCLLLGWRGRPIMLASAWR 511
                  ******************************************99998766..6778899**************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098550.064117493IPR005202Transcription factor GRAS
PfamPF035142.6E-98143511IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 519 aa     Download sequence    Send to blast
MEAMNTWLSF PSQRSLDQDL AIRQFCPARI EQEQEEWQEE TYVINEAELW LPSDDVSSGI  60
QAYEEELFVD SFFNNEYYNE CLNGEQEVFE QFDDDHEGMT MAIDYEYLPV MVEDELVMTN  120
FCEDGGLVAE DACNDGVDQG LHLVHLLLAC AEAVGCRDTL HARAMLSQIW TCVSPWGDSL  180
QRVAYCFAMG LDARLSLLNH VKANGILENG SGDQSLITKE ERLEAFYLLH QTTPYISFGF  240
MAANDAICEA AEGKDFLHIV DLGMEHTLQW PHLVRKLAAR LGGPPKLIRI TGINDLCVKE  300
YQMQDTIVEA ESLGISVKFC RIDEAVTESL LTKENLDIRE GEALFVNSLM QLHKYVKESR  360
GSLKIILQAI KKLEPTLLTV VEQDANLNGP FFLGRFLESL HYYSAVFDSL ESSLPRNSIE  420
RMKIEKLYFA EEIRNIVAYE GADRIQRYDR ADQWRRQLSR AGFQSVGFRN PNLTNLSVSL  480
CQSDGYTLAT DKNCLLLGWR GRPIMLASAW RIHSVSSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A6e-5515051426382Protein SCARECROW
5b3h_A6e-5515051425381Protein SCARECROW
5b3h_D6e-5515051425381Protein SCARECROW
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017257207.10.0PREDICTED: scarecrow-like protein 21
TrEMBLA0A164X5420.0A0A164X542_DAUCS; Uncharacterized protein
STRINGXP_006493798.10.0(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA140671113
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.11e-68RGA-like 1