PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_019886
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family G2-like
Protein Properties Length: 384aa    MW: 43184.3 Da    PI: 7.2867
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_019886genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.61.4e-3348102155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  kprl+Wtp+LHerF+eav+qLGG++kAtPk++l+lm+++gLtl+h+kSHLQkYRl
  DCAR_019886  48 KPRLKWTPDLHERFIEAVNQLGGADKATPKSVLKLMGIQGLTLYHLKSHLQKYRL 102
                  79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.3845105IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-3146103IPR009057Homeodomain-like
SuperFamilySSF466898.06E-1747103IPR009057Homeodomain-like
TIGRFAMsTIGR015576.3E-2448103IPR006447Myb domain, plants
PfamPF002492.2E-1050101IPR001005SANT/Myb domain
PfamPF143793.7E-24147192IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MYHHRQQQHQ TNNLQPCSRM FMAPERRLFL QGGNVTRDSG LVLSTDAKPR LKWTPDLHER  60
FIEAVNQLGG ADKATPKSVL KLMGIQGLTL YHLKSHLQKY RLSKNIHGQA NTGSSKVGLV  120
AAEDLTPEAN ESHMLNSSIG THNKNPHISE AIQMQIEVQR QLHEQLEVQR HLQLRIEAQG  180
KYLQAVLEKA QDTITKQNLG ELGHEATKAR LSEPVSTAYN RCLNSTNHVQ SSCEQQKQSN  240
LEGSLDSCIT SSGGSLRNQD LNSNVMHSTN LVFAPMKSSK IDNDPRNQAF DAELQAIELS  300
MNIQRGKWYD DKSYNHEGLK ETNDGIGYTG KITKRTDSGK PENDDTMQES QLACFMPKLD  360
LNIHDENDAT LRCKQFDLNS FNW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-2247104158Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-2247104158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-2247104158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-2247104158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-2247104158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-2247104158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-2247104158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-2247104158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that may activate the transcription of specific genes involved in nitrogen uptake or assimilation (PubMed:15592750). Acts redundantly with MYR1 as a repressor of flowering and organ elongation under decreased light intensity (PubMed:21255164). Represses gibberellic acid (GA)-dependent responses and affects levels of bioactive GA (PubMed:21255164). {ECO:0000269|PubMed:21255164, ECO:0000305|PubMed:15592750}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by nitrogen deficiency. {ECO:0000269|PubMed:15592750}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017255488.10.0PREDICTED: putative two-component response regulator ARR20 isoform X1
SwissprotQ9SQQ91e-107PHL9_ARATH; Myb-related protein 2
TrEMBLA0A161YHV60.0A0A161YHV6_DAUCS; Uncharacterized protein
STRINGXP_009630167.11e-130(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29462451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.31e-109G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Nakano Y,Naito Y,Nakano T,Ohtsuki N,Suzuki K
    NSR1/MYR2 is a negative regulator of ASN1 expression and its possible involvement in regulation of nitrogen reutilization in Arabidopsis.
    Plant Sci., 2017. 263: p. 219-225
    [PMID:28818378]