PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_019840
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family G2-like
Protein Properties Length: 393aa    MW: 44193.2 Da    PI: 5.9404
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_019840genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like986.7e-31225279155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  k+r+rW+++LH+rFve+v++LGGsekAtPk+il+lm+ + Lt++hvkSHLQkYR+
  DCAR_019840 225 KTRIRWSQDLHDRFVECVNRLGGSEKATPKAILRLMESDVLTIYHVKSHLQKYRI 279
                  68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-27224280IPR009057Homeodomain-like
SuperFamilySSF466893.05E-15224279IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-23225280IPR006447Myb domain, plants
PfamPF002496.0E-7229278IPR001005SANT/Myb domain
PfamPF143791.3E-19310355IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MKFQKVCFQE RIQQNHGLVD GFHFDHAKHF SQLNGVQTGI FVGGSQNIDD HANVASTIIS  60
HIGSPGSAFF ATERYMGLPY YDYQDNNPDL GPEIPKNFDD QIPRFQQSVG ENLYVDQSSV  120
EQVKTGFASS ESTAKPVSCP DDQYHNTVSE KSYSERDRIM QLKRKLFEDN YDPPDKRQAS  180
LTCDGDSSIS LSNNSYGYQL TNMGQSTGAN GNAVVPSGSA TISCKTRIRW SQDLHDRFVE  240
CVNRLGGSEK ATPKAILRLM ESDVLTIYHV KSHLQKYRIA KYMPDSAEGK SEKQTGMSDT  300
EQIGTKTGMY LKEALQMQLD VQKRLHEQLE IQRHLQLRIE EQGKQLKEMF DLQQQKTTGV  360
IESQKSSTET SPRDEPLITK IDGNLQCPVE ID*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-21225282259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-21225282259Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-21225282158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-21225282158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-21225282158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-21225282158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-21225282259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-21225282259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-21225282259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-21225282259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-21225282259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-21225282259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017255606.10.0PREDICTED: uncharacterized protein LOC108225284
TrEMBLA0A164X7640.0A0A164X764_DAUCS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24912458
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.13e-64G2-like family protein