PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_018983
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family G2-like
Protein Properties Length: 376aa    MW: 42644.1 Da    PI: 4.9276
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_018983genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like68.21.3e-21176228355
      G2-like   3 rlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                   +rWt eL erF +av++LGG+ +A Pk+il+ mkv+gL  +h+kSHLQk R+
  DCAR_018983 176 YIRWTGELEERFSRAVQELGGPFRARPKAILKKMKVQGLEHDHIKSHLQKVRS 228
                  589***********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.6E-20173230IPR009057Homeodomain-like
SuperFamilySSF466892.69E-10173230IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-18175229IPR006447Myb domain, plants
PfamPF002495.0E-6178226IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MSYFPVSANW GHPSAHRHMY TRNDVNRRHL MNSVPNNPAM YHLQPPQPQP HPHFEEPSQP  60
QPLQDQFWIP FQPEPFPEYG VPFQPEPYQD QFGIPFQPEP SQVLGIPAQW VPLYYGAPPQ  120
WHPYQPLQPQ PHQAPQPQPL EHFEMPQQPQ IEMPRDPGED VLVLNPNVSL FTAKTYIRWT  180
GELEERFSRA VQELGGPFRA RPKAILKKMK VQGLEHDHIK SHLQKVRSKA RPKPVDQEPA  240
VVQSSSDNAQ LPPGEASSDT GLNDCIIFLN ATCANSSGDV QSFLEDIEYY GRLLGSPETP  300
SFMQFLEVAQ PDHLQQEEGG VAQPDHPQHE EHQEDGVAQP DHPQHQEDGV AQADHPQHQD  360
GVTQPDHPQH QEDGE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A164ZCY60.0A0A164ZCY6_DAUCS; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.18e-15phosphate starvation response 1