PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_018919
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 545aa    MW: 60366.9 Da    PI: 4.2487
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_018919genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS115.57e-363965311137
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  l++lL++cA+ v+ +d + a + L+ ++e++s +gd+ qRl + f+++L+ar+++++s+ly+a  +s+ +  + +e l+a++++  ++P+ k s l  
  DCAR_018919 396 LRTLLINCAQSVACEDRKTAYEQLKLIREHSSASGDASQRLGFIFANGLEARMTGTGSQLYAAALSSRRR-ISATEMLKAYQAYLSACPFKKTSVLFS 492
                  6789*********************************************************887666665.7899*********************** PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpe 137
                  N++Ile +++++++HiiDf+i++G+QWp L+q L++Rp+
  DCAR_018919 493 NKMILEKASNATTLHIIDFGIQYGFQWPVLIQLLSKRPD 531
                  *************************************84 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098527.909370544IPR005202Transcription factor GRAS
PfamPF035142.4E-33396531IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 545 aa     Download sequence    Send to blast
MDSQYADFSD VLNGFEFGDG ILLPGFDSSP DLGNGFKFSD EIALPGFNSV VNSFNGIKFR  60
DELDFGFLDI PNPPDEPGYA TTISPTGSSE LDSPDENELS DGMLKFLDEI LMEDVIDERP  120
SMFHDPLALQ ASEKSFNEVV SKKYPSSPYG QMDIYQGVES PDDYFSRSPS ENSTSSGGTS  180
SENYFEPLQS VADSGGPESS NVQNLTQEDF TSNPGSRLPW SVIPDNSFSN NINGDMNAAV  240
STQAVQSIFS ERESILQFQR GMEEANKFLP DISQLLVNLD NYKLPTKAKE VPPAIQVKIE  300
KDEEISPSSS RRRKHYLRQD SMIEDERSSK QSAVYDEEVE LSEMFDKVLL YEPGCGKEEP  360
IEWNPVSPLE NGPTHEYDGS RSHSTITENY SEAVDLRTLL INCAQSVACE DRKTAYEQLK  420
LIREHSSASG DASQRLGFIF ANGLEARMTG TGSQLYAAAL SSRRRISATE MLKAYQAYLS  480
ACPFKKTSVL FSNKMILEKA SNATTLHIID FGIQYGFQWP VLIQLLSKRP DLNIHGLKSW  540
ALGS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-184005438153GRAS family transcription factor containing protein, expressed
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017251629.10.0PREDICTED: scarecrow-like protein 14
TrEMBLA0A164ZBP10.0A0A164ZBP1_DAUCS; Uncharacterized protein
STRINGXP_009606498.11e-131(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27624191
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-70SCARECROW-like 14