PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_018918
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 510aa    MW: 56263.2 Da    PI: 4.4281
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_018918genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS93.92.5e-293804971121
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  l++lL++cA+ v+++d + a + L+ ++++as +gd+ qRla  f+++L+ar+a+++++ly+al++++ s    +e+l+a++++  ++P+ k+s + a
  DCAR_018918 380 LRTLLISCAQSVAADDRKTAYEQLKLIRQHASASGDASQRLAVIFANGLEARMAGTGTQLYAALSSKRIS---AIEKLKAFQVYLSACPFTKISVFFA 474
                  6789************************************************************999999...9************************ PP

         GRAS  99 NqaIleavegeervHiiDfdisq 121
                  N++I++ +++++++HiiDf+i++
  DCAR_018918 475 NNMIMDMASNASTLHIIDFGIQH 497
                  *********************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098522.848354509IPR005202Transcription factor GRAS
PfamPF035148.8E-27380497IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009410Biological Processresponse to xenobiotic stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
Sequence ? help Back to Top
Protein Sequence    Length: 510 aa     Download sequence    Send to blast
MVMDPGYNDT SGAINDFDFG DEMILPGFDQ STNIVNGFKL NDDYVDLSFL DIPDRPVEHR  60
PGYANNNSSS GSSEVNSPDE FSDGVLKFLN QILMEEKIDE KPSMFHDPLA LQEAEKSFYE  120
VLGKQYPQQT FQPPADIYQS VESVSDYFAG SSSEASTSSG NSVGNNHYEH SQWAGDSLDL  180
RSSIQHNQPS QYLSFSNMES RPERTVASEN SFNNNINGSM DYSMSTHVIS NIFNDKDSML  240
QFKKGMEEAS KFLPSIPQIV VNLDNYALPS DTKEGHPAVQ VKVEMDEISP SSSRGRKQYQ  300
RQDSLSEEDE RSSKQMAVYE EEVELSEMFD KVLLLGPSCG KEEPIEGSAV AHLDNVTTRG  360
AKGAKSRSVN IDNNTESVDL RTLLISCAQS VAADDRKTAY EQLKLIRQHA SASGDASQRL  420
AVIFANGLEA RMAGTGTQLY AALSSKRISA IEKLKAFQVY LSACPFTKIS VFFANNMIMD  480
MASNASTLHI IDFGIQHNNL KPTSFVNPD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A6e-1138750525146Protein SCARECROW
5b3h_D6e-1138750525146Protein SCARECROW
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017253161.10.0PREDICTED: scarecrow-like protein 14
TrEMBLA0A161XV660.0A0A161XV66_DAUCS; Uncharacterized protein
STRINGXP_009606498.11e-131(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27624191
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.14e-93SCARECROW-like 14