PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_018901
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family WOX
Protein Properties Length: 257aa    MW: 28862.2 Da    PI: 7.1792
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_018901genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.43.9e-212685357
                 --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
     Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                 +R+++tkeq++ Le+++++  r+psae+++++++kl    +++ ++V++WFqN++a++++
  DCAR_018901 26 HRWNPTKEQINMLENMYKQgIRTPSAEQIQDITTKLkvygHIEGKNVFYWFQNHKARQRQ 85
                 7*****************99**************************************97 PP

2Wus_type_Homeobox114.64.8e-372487265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       +++RW+Pt+eQi++Le++yk+G+rtP++e+iq+it++L+ yG+ie+kNVfyWFQN+kaR+rqkq
        DCAR_018901 24 STHRWNPTKEQINMLENMYKQGIRTPSAEQIQDITTKLKVYGHIEGKNVFYWFQNHKARQRQKQ 87
                       679***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.25E-131790IPR009057Homeodomain-like
PROSITE profilePS5007111.1592186IPR001356Homeobox domain
SMARTSM003897.6E-72390IPR001356Homeobox domain
PfamPF000468.9E-192685IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.0E-82685IPR009057Homeodomain-like
CDDcd000861.74E-62687No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MESDHQIGME STISSPPSGA GSPSTHRWNP TKEQINMLEN MYKQGIRTPS AEQIQDITTK  60
LKVYGHIEGK NVFYWFQNHK ARQRQKQKQD TRMAESFSRF LQHSSPSLFP PPPCPNVVCS  120
PYYMGPGPVG FFPQCPPKLY LPPAIGKKRS QGIASDENYM GKPNFWDHGE SGDQRWRMPL  180
MRSPSNQETL ELFPMHPTGI LQEKMTPNQS PENSNVTTPA TTPSSSDTAP CFNEQEAAAA  240
DQRFFDFFRG NEEGSS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017251963.10.0PREDICTED: WUSCHEL-related homeobox 5-like
TrEMBLA0A161YP180.0A0A161YP18_DAUCS; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA114141925
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.13e-35WUSCHEL related homeobox 2