PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_018677
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family G2-like
Protein Properties Length: 352aa    MW: 39680.9 Da    PI: 6.4198
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_018677genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.31.3e-3166119255
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  prlrWt++LH rFv+ave+LGG+e+AtPk +l+lm+vkgL ++hvkSHLQ+YR+
  DCAR_018677  66 PRLRWTHDLHLRFVQAVERLGGQERATPKLVLQLMNVKGLNIAHVKSHLQMYRS 119
                  8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.16462122IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.5E-3062120IPR009057Homeodomain-like
SuperFamilySSF466895.91E-1563120IPR009057Homeodomain-like
TIGRFAMsTIGR015574.4E-2366121IPR006447Myb domain, plants
PfamPF002493.1E-867118IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MDGSSRSECY KASPSNEEYE EDEEDVSAEN NSKATDGGAG GSSSNSTIEE NENKSSVRPY  60
VRSKTPRLRW THDLHLRFVQ AVERLGGQER ATPKLVLQLM NVKGLNIAHV KSHLQMYRSK  120
KIDDPNQAIA DNRSVENYGD RNIYNLSQLP MLQSYNQSYN LSTFRYGDAL WNAGHHEKWM  180
QNVYNMSGRN GAVDYKARPR FYPSVTEKIS GRNSINWENN INASSSSQLS TWKVHENKGE  240
LLGPLNDQSP VKFMEFKSSN RQQEKVEPLD LEIASLTPAK RKASACELDL NLTLAVKSTN  300
DNSGRNLKDD EDEYLSLSLF SPSSSKKLER LKMVDKEEIN AERASTLDLT I*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-1667121458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-1667121458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-1667121357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-1667121357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-1667121357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-1667121357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-1667121458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-1667121458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-1667121458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-1667121458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-1667121458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-1667121458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00297DAPTransfer from AT2G38300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017251636.10.0PREDICTED: putative Myb family transcription factor At1g14600
TrEMBLA0A164Z6V70.0A0A164Z6V7_DAUCS; Uncharacterized protein
STRINGEOY071172e-89(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43822141
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.11e-53G2-like family protein