PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_018514
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family G2-like
Protein Properties Length: 345aa    MW: 37252.1 Da    PI: 5.8654
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_018514genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.92.4e-33261315155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  k r+rWtpeLHe+Fveav++LGGse+AtPk +l+ mkv+gLt++hvkSHLQkYR+
  DCAR_018514 261 KSRMRWTPELHEAFVEAVNKLGGSERATPKGVLKQMKVEGLTIYHVKSHLQKYRT 315
                  68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.158258318IPR017930Myb domain
SuperFamilySSF466891.31E-17259315IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.6E-31259317IPR009057Homeodomain-like
TIGRFAMsTIGR015575.4E-25261315IPR006447Myb domain, plants
PfamPF002491.7E-10263314IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0016036Biological Processcellular response to phosphate starvation
GO:0055063Biological Processsulfate ion homeostasis
GO:0071486Biological Processcellular response to high light intensity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MEARPGLAFQ RSGARSLNNH GASGALPSSF PVLSSPRLTD YQEVSMERVV VSNPANVRPV  60
LSSSSGAVGH IFSSSAGFST DLQYSTSAPH EKHSRKAPFI SQSSNPVATM PLNNCDSGVF  120
KSTASSRYTT ENNNDSWCTE SVRSYLDGPA NSPGVNNQIN DNNAICVMPS EDFSKTSDWQ  180
EWADQLITDD EALPSDWDNI LVDTGAGGPE PQQVSSTPIN CPVQQPQVHQ QYQVNQQLPA  240
SSGEICTVTT PSSSAGGSST KSRMRWTPEL HEAFVEAVNK LGGSERATPK GVLKQMKVEG  300
LTIYHVKSHL QKYRTARYKP ESTEGTSERK LTPIEELSSL DLKT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-33261319260Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-33261319260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-33261319260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-33261319260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-33261319260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-33261319260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-33261319260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-33261319260Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017253223.10.0PREDICTED: protein PHR1-LIKE 1
RefseqXP_017253224.10.0PREDICTED: protein PHR1-LIKE 1
TrEMBLA0A162A2P90.0A0A162A2P9_DAUCS; Uncharacterized protein
STRINGXP_002526559.11e-134(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27532349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.12e-68phosphate starvation response 1