PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_018296
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 448aa    MW: 50792.6 Da    PI: 6.0993
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_018296genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS291.91.7e-89814454374
         GRAS   4 lLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                   Ll++Ae ++ ++  +a++ L++ + +as +g+p+qR+  yf+ AL++r+ r ++  + +   p+  +   s + l  +    +  P+ k+++++a q
  DCAR_018296  81 HLLTAAENLTYKQYDRASRSLTQSQSMASDTGNPVQRVSYYFAAALRERIDReTGRFTNQEGGPTGFT---SNTDLDTFYSSDQELPLSKVTQFAAVQ 175
                  699*************************************************4444444444555555...334444444456788************ PP

         GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvk 197
                  ++ ++v+++ +vHiiD++i  G+QW aL+qaLa+R++ p   l+iT+ +    +++e++eetg+rL+++A+ l++pf+f+++v  +++d++ e +++k
  DCAR_018296 176 TVIDSVANDVKVHIIDLQIRSGVQWTALMQALAKRNSCPLeLLKITATAT---TDRENVEETGKRLQRYAKFLNIPFSFKIVVIPDMKDIKEELFDIK 270
                  ************************************6655499*****99...68******************************************* PP

         GRAS 198 pgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreiv 295
                  +gE+++V +   l ++ +++  +e     +++++++ +P ++vv+e ea+hns+sF++rf+eal +ysa fd+le  + r++e r+ +E+ +++r i+
  DCAR_018296 271 TGETVVVYSPTVLTTMISRPERVEA----LMRVIRRFKPSIMVVIEVEANHNSPSFVNRFIEALFFYSAWFDCLEDCMDRNNEYRVILEKNYFSRGIQ 364
                  ****************966655555....********************************************************************* PP

         GRAS 296 nvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrk.vk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  n+va+eg+er+ r  + + Wre + ++ +++ ++s+   ++a l l++ ++ ++  ++++++++l+ gWk+ p++svSaWr
  DCAR_018296 365 NIVATEGDERVTRSVKINVWREFFARFRMEETEVSTLSLCDATLALQTqFPcGNSCTLDSNKKCLIVGWKKTPIYSVSAWR 445
                  *******************************************9998625677889999*********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.74452423IPR005202Transcription factor GRAS
PfamPF035145.8E-8781445IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 448 aa     Download sequence    Send to blast
MAYNFSASGI NDSQGSYRPL ASLEYKEQKL STADIMRVAG ERYIQFSNNH LDAITMFIHP  60
YSSSLSALST EEASGADLAY HLLTAAENLT YKQYDRASRS LTQSQSMASD TGNPVQRVSY  120
YFAAALRERI DRETGRFTNQ EGGPTGFTSN TDLDTFYSSD QELPLSKVTQ FAAVQTVIDS  180
VANDVKVHII DLQIRSGVQW TALMQALAKR NSCPLELLKI TATATTDREN VEETGKRLQR  240
YAKFLNIPFS FKIVVIPDMK DIKEELFDIK TGETVVVYSP TVLTTMISRP ERVEALMRVI  300
RRFKPSIMVV IEVEANHNSP SFVNRFIEAL FFYSAWFDCL EDCMDRNNEY RVILEKNYFS  360
RGIQNIVATE GDERVTRSVK INVWREFFAR FRMEETEVST LSLCDATLAL QTQFPCGNSC  420
TLDSNKKCLI VGWKKTPIYS VSAWRFN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-379744522375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017250980.10.0PREDICTED: DELLA protein RGL2-like
TrEMBLA0A164YYE60.0A0A164YYE6_DAUCS; Uncharacterized protein
STRINGAquca_018_00004.11e-161(Aquilegia coerulea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46941842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.18e-57RGA-like 1