PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_017856
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family G2-like
Protein Properties Length: 509aa    MW: 56106.8 Da    PI: 6.8577
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_017856genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like32.12.6e-10267296130
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPk 30 
                  k+r++W+p+LH+rFv+a++ LGGs+  + k
  DCAR_017856 267 KARRCWSPDLHRRFVSALQILGGSQAMIVK 296
                  68*********************9876555 PP

2G2-like52.98.2e-173193502556
      G2-like  25 ekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                   +AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  DCAR_017856 319 AVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 350
                  68****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.15E-12264292IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.9E-26265353IPR009057Homeodomain-like
TIGRFAMsTIGR015578.3E-14319350IPR006447Myb domain, plants
SuperFamilySSF466891.15E-12322353IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 509 aa     Download sequence    Send to blast
MASSSELTLN CKPHNSYSML LKSFGGDHLG AVNDQNQTQK LEDFLSRLEE ERLKIDAFKR  60
ELPLCMQLLN NAMETFRQQL QTYRASQGGQ RPVLEEFIPI KVQSNSDCSE KTLNMSDSKA  120
NWMTSAQLWS QTNDKTKQQQ TISSASPKET PDIGFLVSPN LGLDAKQRNG TGAFLPFSKD  180
RSSCPAGTTR GLPELALAPL DNKEIGDKKC LEINDIGMSN CSRVENPTLT AGMITEHGKT  240
AGVHEDLQTV STNNGITSTT TSQTHRKARR CWSPDLHRRF VSALQILGGS QAMIVKVLLY  300
LILYVHKFIE ADLFGLMIAV ATPKQIRELM KVDGLTNDEV KSHLQKYRLH TRRPSPSPQS  360
TGTGAPQLVV LGGIWVPSEY AAAHHGGAPS LYGAHPGHVN SPHYPVPQEY YSALAPQAQG  420
HHQLHNHTLH QQLHMYKQPS SQTQSSPQSD IRGNTNDQSE SIEDGKSENS ASWKNDSEGA  480
AENGREEKGL VLREDGEESN ESDITLKF*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017250156.10.0PREDICTED: uncharacterized protein LOC108220808
TrEMBLA0A164YJM10.0A0A164YJM1_DAUCS; Uncharacterized protein
STRINGevm.model.supercontig_127.551e-178(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA87942229
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-113G2-like family protein