PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_017156
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family NAC
Protein Properties Length: 313aa    MW: 34625.6 Da    PI: 8.9592
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_017156genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1614.6e-50151401128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  lppGfrF+Ptdeel+v+yL++kv+g++ ++   i +vd+yk++Pw Lp k+  ++kewyfFs+rd+ky++g+r+nr + sgyWkatg+dk + s +g+
  DCAR_017156  15 LPPGFRFNPTDEELMVNYLCPKVAGETSSF-ILIGDVDLYKHDPWVLPGKALFGDKEWYFFSPRDRKYPNGSRPNRGAGSGYWKATGTDKVIAS-EGK 110
                  79*************************888.88***************8777899*********************99**************99.999 PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                    g+kk+Lvfy g+ap+g+kt+W+mheyrl
  DCAR_017156 111 RLGIKKSLVFYIGKAPTGSKTNWIMHEYRL 140
                  9***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.45E-6411164IPR003441NAC domain
PROSITE profilePS5100558.915163IPR003441NAC domain
PfamPF023653.6E-2616140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MGVAETVDPL SKLSLPPGFR FNPTDEELMV NYLCPKVAGE TSSFILIGDV DLYKHDPWVL  60
PGKALFGDKE WYFFSPRDRK YPNGSRPNRG AGSGYWKATG TDKVIASEGK RLGIKKSLVF  120
YIGKAPTGSK TNWIMHEYRL LEPQRTKGSS KLDDWVLCRI YKKNSSAQRA GNMARTECSH  180
GSSSSTSFQF DDKQNVQNAG CYSGNNIDWA PLAGLNNTMT GHSGVIQFQL HNETQQGAMN  240
TMNYNQTNMY PSVDTGYGKV AEQEVQSGFP NQRADNSGFL YPNAYAQGFI NSVDPYAAIR  300
YQNQPGNSGN RN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-9811694171NO APICAL MERISTEM PROTEIN
1ut4_B9e-9811694171NO APICAL MERISTEM PROTEIN
1ut7_A9e-9811694171NO APICAL MERISTEM PROTEIN
1ut7_B9e-9811694171NO APICAL MERISTEM PROTEIN
4dul_A9e-9811694171NAC domain-containing protein 19
4dul_B9e-9811694171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that acts downstream of MYC2 in the jasmonate-mediated response to Botrytis cinerea infection (PubMed:28733419). With MYC2 forms a transcription module that regulates wounding-responsive genes (PubMed:28733419). Involved in jasmonate- and coronatine-mediated stomatal reopening in response to Pseudomonas syringae pv tomato DC3000 infection (PubMed:25005917). Regulates the expression of threonine deaminase 2 (TD2) through promoter binding (PubMed:28733419). {ECO:0000269|PubMed:25005917, ECO:0000269|PubMed:28733419}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by jasmonate (JA) (PubMed:25005917, PubMed:28733419, PubMed:30610166). Induced by wounding (PubMed:28733419, PubMed:25005917). Induced by infection with the fungal pathogen Botrytis cinerea (PubMed:28733419). Induced by coronatine (PubMed:25005917). {ECO:0000269|PubMed:25005917, ECO:0000269|PubMed:28733419, ECO:0000269|PubMed:30610166}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017250330.10.0PREDICTED: NAC domain-containing protein 72
SwissprotA0A3Q7HH641e-100JA2L_SOLLC; NAC domain-containing protein JA2L
TrEMBLA0A164Y3330.0A0A164Y333_DAUCS; Uncharacterized protein
STRINGevm.model.supercontig_80.931e-109(Carica papaya)
STRINGXP_002533913.11e-109(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31222452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G52890.14e-98NAC domain containing protein 19
Publications ? help Back to Top
  1. Tomato Genome Consortium
    The tomato genome sequence provides insights into fleshy fruit evolution.
    Nature, 2012. 485(7400): p. 635-41
    [PMID:22660326]
  2. Du M, et al.
    MYC2 Orchestrates a Hierarchical Transcriptional Cascade That Regulates Jasmonate-Mediated Plant Immunity in Tomato.
    Plant Cell, 2017. 29(8): p. 1883-1906
    [PMID:28733419]
  3. Liu Y, et al.
    MYC2 Regulates the Termination of Jasmonate Signaling via an Autoregulatory Negative Feedback Loop.
    Plant Cell, 2019. 31(1): p. 106-127
    [PMID:30610166]