PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_017092
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 549aa    MW: 60911.5 Da    PI: 4.9966
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_017092genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS404.21.2e-1231795471373
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  l+e+L++cA+av+++dl+ a++l++rl  ++s +g+p+qRl ay++e+L arl +s +   k+++++e +   sse l++++l++ev+P++kf++++a
  DCAR_017092 179 LKEVLVSCARAVADNDLSSADSLMSRLGPMVSVTGNPVQRLGAYMLEGLVARLGSSATPYHKSIRCKEPT---SSELLSYMHLLYEVCPYYKFGYMAA 273
                  5789*****************************************************************9...9************************ PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeL 194
                  N aI ea++ e+  HiiDf+is+G QW +L+qa+++Rp+gpp++RiTgv++ +s   +   l  +gerL+++Ae+++vpf+fn+ + ++  dl++++L
  DCAR_017092 274 NGAIAEAMKDENSFHIIDFQISEGSQWFTLIQAFSARPGGPPRIRITGVDDTTSAfyRGGGLDIVGERLSSLAESCRVPFKFNATTISN-FDLDFNTL 370
                  ***************************************************9988999**************************65555.5688**** PP

         GRAS 195 rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgr 292
                  ++ pgEalaVn++++lh+++d +++   +rd++L+ vk+l Pkvv+++eqea++n + F  rfle+++yy+a+f+s+++ lpr+++eri  E ++l+r
  DCAR_017092 371 EIIPGEALAVNFAYMLHHMPDGNGEKIYQRDKILSSVKNLCPKVVTLIEQEANTN-TCFIPRFLETFKYYMAVFESIDVMLPRDNQERIGAETHCLAR 467
                  *********************9999999*************************96.57**************************************** PP

         GRAS 293 eivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                  +ivn++aceg++r+erhe lekWr+r+ +aGFkp pl++++++++k ll+++  + y++ee++g+l+lgW++++Lv+++aW
  DCAR_017092 468 DIVNLIACEGTDRVERHEILEKWRSRFVAAGFKPFPLNSYINATIKNLLKNYC-EHYTLEEREGALYLGWMEQNLVATCAW 547
                  ****************************************************9.55************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.122153529IPR005202Transcription factor GRAS
PfamPF035144.3E-121179547IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 549 aa     Download sequence    Send to blast
MKGYSSMHST HEQQYIGQSS RVSEQPAHEF QSYLQKPCGT LDNQLFSADG SQQMQFPGKL  60
SQSFNTPEGA TSIGGHSGNS SFTVSYSATI SPISHADPHT YPSFTSDNTN NLQVGETSYS  120
SDFDTLKKKI KEIETLLLGP EPDISISNET YMYGGPSEIS STKEVSKQMI TGVSDDDDLK  180
EVLVSCARAV ADNDLSSADS LMSRLGPMVS VTGNPVQRLG AYMLEGLVAR LGSSATPYHK  240
SIRCKEPTSS ELLSYMHLLY EVCPYYKFGY MAANGAIAEA MKDENSFHII DFQISEGSQW  300
FTLIQAFSAR PGGPPRIRIT GVDDTTSAFY RGGGLDIVGE RLSSLAESCR VPFKFNATTI  360
SNFDLDFNTL EIIPGEALAV NFAYMLHHMP DGNGEKIYQR DKILSSVKNL CPKVVTLIEQ  420
EANTNTCFIP RFLETFKYYM AVFESIDVML PRDNQERIGA ETHCLARDIV NLIACEGTDR  480
VERHEILEKW RSRFVAAGFK PFPLNSYINA TIKNLLKNYC EHYTLEEREG ALYLGWMEQN  540
LVATCAWS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A5e-5318654825378Protein SCARECROW
5b3h_D5e-5318654825378Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in phytochrome A (phyA) signal transduction. {ECO:0000269|PubMed:10817761}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017250694.10.0PREDICTED: scarecrow-like protein 21
SwissprotQ9LDL70.0PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLA0A164Y1J80.0A0A164Y1J8_DAUCS; Uncharacterized protein
STRINGVIT_12s0057g00560.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68124111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Heyman J, et al.
    The heterodimeric transcription factor complex ERF115-PAT1 grants regeneration competence.
    Nat Plants, 2016. 2(11): p. 16165
    [PMID:27797356]