PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_016851
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family G2-like
Protein Properties Length: 311aa    MW: 35037.6 Da    PI: 7.2906
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_016851genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.91.1e-331771155
      G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                 kprlrWt eLH+rFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  DCAR_016851 17 KPRLRWTAELHDRFVDAVTQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 71
                 79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.4E-321472IPR009057Homeodomain-like
PROSITE profilePS5129411.5211474IPR017930Myb domain
SuperFamilySSF466896.63E-171672IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-241772IPR006447Myb domain, plants
PfamPF002497.4E-81969IPR001005SANT/Myb domain
PfamPF143791.5E-20114154IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MPCLRADSGL VLTTDPKPRL RWTAELHDRF VDAVTQLGGP DKATPKTIMR VMGVKGLTLY  60
HLKSHLQKFR LGRQPHKDNT SDGHTMKDGE RGSAMKLYGN SASSSGMITS NMNEMQMEVQ  120
RRMHEQLEVQ RNLQLRIETQ GKYMQTILEK ACQTLAGENM PNNRQGRKGD GPTHHMRDYG  180
PNLNFLVPQD LNQLYGSDPQ PLEVFHHQQL SMERTDSSLD RFMSGSIDDS NLCLGKKRPK  240
TDCSSKSLII WPDDLRLDQE FGNAALCLGS QYNDEYLYCG ARSSEGEQKR VLSEDDMDDK  300
KLNSAQLGMS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A6e-201773157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B6e-201773157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C6e-201773157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D6e-201773157Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor required for phloem identity. Has a dual role both in promoting phloem differentiation and in repressing xylem differentiation during vascular development. Regulates the expression of the transcription factor NAC045 (AC A4VCM0). May activate the transcription of specific genes involved in phosphate uptake or assimilation (PubMed:15592750). Promotes flowering through transcriptional activation of both FT and its transport machinery component, FTIP1 (PubMed:26239308). {ECO:0000269|PubMed:14614507, ECO:0000269|PubMed:18523061, ECO:0000269|PubMed:25081480, ECO:0000269|PubMed:26239308, ECO:0000305|PubMed:15592750}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by phosphate deficiency. {ECO:0000269|PubMed:15592750}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017251591.10.0PREDICTED: myb family transcription factor APL-like
SwissprotQ9SAK55e-92APL_ARATH; Myb family transcription factor APL
TrEMBLA0A164XUR40.0A0A164XUR4_DAUCS; Uncharacterized protein
STRINGevm.model.supercontig_32.941e-105(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA79422231
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79430.22e-94G2-like family protein
Publications ? help Back to Top
  1. Martínez-Navarro AC,Galván-Gordillo SV,Xoconostle-Cázares B,Ruiz-Medrano R
    Vascular gene expression: a hypothesis.
    Front Plant Sci, 2013. 4: p. 261
    [PMID:23882276]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Kondo Y, et al.
    Vascular Cell Induction Culture System Using Arabidopsis Leaves (VISUAL) Reveals the Sequential Differentiation of Sieve Element-Like Cells.
    Plant Cell, 2016. 28(6): p. 1250-62
    [PMID:27194709]
  4. Shibuta M,Abe M
    FE Controls the Transcription of Downstream Flowering Regulators Through Two Distinct Mechanisms in Leaf Phloem Companion Cells.
    Plant Cell Physiol., 2017. 58(11): p. 2017-2025
    [PMID:29036620]