PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_016829
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family LBD
Protein Properties Length: 176aa    MW: 19329.8 Da    PI: 7.4671
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_016829genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260147.15e-46131121100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+Ca+dCv+apyfpa++p+kfa vhk+FGasnv k+l++lpe++r da+ss+vyeA+ar+rdPvyG+vg i++lqqq+++l+a+la+++
  DCAR_016829  13 PCAACKLLRRRCAQDCVFAPYFPADEPHKFASVHKVFGASNVNKMLQDLPEHQRGDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDSLQAQLAQAQ 110
                  7**********************************************************************************************999 PP

       DUF260  99 ee 100
                  +e
  DCAR_016829 111 AE 112
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.23912113IPR004883Lateral organ boundaries, LOB
PfamPF031951.4E-4513110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MRESGRKQGV ASPCAACKLL RRRCAQDCVF APYFPADEPH KFASVHKVFG ASNVNKMLQD  60
LPEHQRGDAV SSMVYEANAR VRDPVYGCVG AISSLQQQID SLQAQLAQAQ AEVVHMQMRQ  120
YSSSVANPNN DNSPENVSPT SKHMMMQSSQ TSTRSLFSMD MVVDHTNMGE SLWSC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-4991147112LOB family transfactor Ramosa2.1
5ly0_B1e-4991147112LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4443039e-33AM444303.2 Vitis vinifera contig VV78X107337.4, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017250105.11e-129PREDICTED: LOB domain-containing protein 4-like
SwissprotQ9SHE92e-74LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A164XU111e-128A0A164XU11_DAUCS; Uncharacterized protein
STRINGSolyc11g045530.1.11e-102(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.12e-65LOB domain-containing protein 4