PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_015927
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 178aa    MW: 20116.1 Da    PI: 7.5017
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_015927genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS186.22.3e-575176197374
         GRAS 197 kpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgrei 294
                  + gEal +n+v +l+r++  + sl     ++L ++++ sP++v+++eqe++hn++ Fl rfl+al+yysa+fdsl+a++p +s +r+kvE+ +   ei
  DCAR_015927   5 RVGEALTINSVNRLQRVP--RNSL----GSLLAMIRDQSPNIVTIAEQETSHNGPYFLGRFLKALHYYSAIFDSLDATFPLDSAHRVKVEQYISTLEI 96 
                  459**************9..4444....45******************************************************************** PP

         GRAS 295 vnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  +n+vace  er++rhe+lekWr+ +e+ GF+ vpls +a++q + ll  ++ dgy++ e++g+l+lgW+drp++++ aWr
  DCAR_015927  97 QNIVACEVPERVMRHEKLEKWRKIMESKGFEGVPLSANAVTQSNILLGLYSCDGYSLTEDHGCLLLGWQDRPILAAYAWR 176
                  *******************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098526.1621156IPR005202Transcription factor GRAS
PfamPF035147.7E-555176IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
MFNRRVGEAL TINSVNRLQR VPRNSLGSLL AMIRDQSPNI VTIAEQETSH NGPYFLGRFL  60
KALHYYSAIF DSLDATFPLD SAHRVKVEQY ISTLEIQNIV ACEVPERVMR HEKLEKWRKI  120
MESKGFEGVP LSANAVTQSN ILLGLYSCDG YSLTEDHGCL LLGWQDRPIL AAYAWRC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A6e-392175206377Protein SCARECROW
5b3h_D6e-392175206377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that functions in mycorrhizal specific signaling (PubMed:23122845). Required for Myc factor signaling from mycorrhizal fungi, but has no function in Nod factor signaling from rhizobial bacteria (PubMed:23122845). Regulates the expression of RAM2, a glycerol-3-phosphate acyl transferase that promotes cutin biosynthesis to enhance mycorrhizal hyphopodia formation (PubMed:23122845). {ECO:0000269|PubMed:23122845}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced in roots during colonization by arbuscular mycorrhizal fungi. {ECO:0000269|PubMed:23122845}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017245655.11e-108PREDICTED: DELLA protein RGL1-like
SwissprotG7L1661e-100RAM1_MEDTR; GRAS family protein RAM1
TrEMBLA0A165A0D31e-130A0A165A0D3_DAUCS; Uncharacterized protein
STRINGXP_006470106.11e-100(Citrus sinensis)
STRINGXP_006447014.11e-100(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA125661922
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.18e-45RGA-like 2
Publications ? help Back to Top
  1. Tang H, et al.
    An improved genome release (version Mt4.0) for the model legume Medicago truncatula.
    BMC Genomics, 2014. 15: p. 312
    [PMID:24767513]
  2. Pecrix Y, et al.
    Whole-genome landscape of Medicago truncatula symbiotic genes.
    Nat Plants, 2018. 4(12): p. 1017-1025
    [PMID:30397259]