PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_015880
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family B3
Protein Properties Length: 318aa    MW: 35394.9 Da    PI: 7.576
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_015880genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B345.91e-1424991392
                 TT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
           B3 13 sgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92
                 ++ +++p kf++++g++   ++ ++l+ + g  W v l   + +++++l++GW +F++   L  g f+vFk++g+s+f  
  DCAR_015880 24 HDKMMIPEKFVRKYGKQ--LHVGVSLKVPGGAFWHVDL--VGDGDKVWLQNGWPKFARFYSLAFGHFLVFKYQGNSQFDV 99
                 678***********966..8999***************..999999****************************999944 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.8E-208105IPR015300DNA-binding pseudobarrel domain
CDDcd100173.15E-1611103No hitNo description
SuperFamilySSF1019367.46E-2111104IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.40712105IPR003340B3 DNA binding domain
SMARTSM010193.2E-913105IPR003340B3 DNA binding domain
PfamPF023622.4E-1222100IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MEMSDSAGKG RSFGKIMFSE ICLHDKMMIP EKFVRKYGKQ LHVGVSLKVP GGAFWHVDLV  60
GDGDKVWLQN GWPKFARFYS LAFGHFLVFK YQGNSQFDVF IYDQRGVEVD YPVDSSLHMN  120
EQKNLNLGEF SQVRKRVAID VDGLKACKKT RANSACAEAC HFGECLIRKL QHKKALVSRL  180
DGNIQPPEQG EIDIYTQQQG FDMHEMVLES SDDETDSSGE DMATQNGGTS ATRRGLSGGF  240
RMSTKSRLTK TMVIGLSAAA HEEKDRHASC SRNGSEAEAX GQVKERLNLT IFTSILSINL  300
DSIPPICAIQ REARPHF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7591893
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.15e-23B3 family protein