PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_015781
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family G2-like
Protein Properties Length: 457aa    MW: 51622.1 Da    PI: 6.1413
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_015781genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like74.81.1e-23116167254
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54 
                  +rl+Wt++LH+rFvea+  + G ++A+P +i e+m+vkgLt+ hv+SHLQkY 
  DCAR_015781 116 KRLVWTSDLHTRFVEAILVI-GYHRAVPTNIFEVMNVKGLTRGHVASHLQKYQ 167
                  7*******************.9******************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23006.8E-6137No hitNo description
SuperFamilySSF521724.72E-7166IPR011006CheY-like superfamily
PROSITE profilePS512949.961112171IPR017930Myb domain
SuperFamilySSF466893.23E-15114172IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.7E-22114171IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-20116167IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 457 aa     Download sequence    Send to blast
MYNILAVDDD RTCLLILKEW LEKWGYQVIS ADTRAEVMCI GIKNGAERFF VKPLVANNFK  60
DIWQFVEWWK RTRSNNTTPL TQINGSSEES RTAVIDSHRD NDNNTLSGNT TGRGRKRLVW  120
TSDLHTRFVE AILVIGYHRA VPTNIFEVMN VKGLTRGHVA SHLQKYQKFL KHVLAGKSNI  180
EFSNWTDLNY HSEFVFGNPD TVLLNQLRNE QREGKLAPHN PLRQPKQGNI NMTARAPNGS  240
LSLFPRLPPL TIEGSSRRAI YATLMQELDS STNVASTGLG SVNSHKAHTQ NMGSIIGSST  300
SNFIHNLSYS TNHMDYYHQN PLAQEHENYS NSANTNMPLG GNHFTPPSKV HLENNFQSYQ  360
LVDVGEEDNN NFSHENNFHH DQLSQLENKH GDPSMGISSG GNHFENTSAM DALELDGKIM  420
TDESWFNNIG GEGDNDYWLN IEFDEDVDKD QNRGDI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A3e-15115171157Transcription factor LUX
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017246393.11e-156PREDICTED: two-component response regulator ORR25-like isoform X1
RefseqXP_017246394.11e-156PREDICTED: two-component response regulator ORR25-like isoform X1
TrEMBLA0A165A3K60.0A0A165A3K6_DAUCS; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31920.13e-22response regulator 10