PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_015660
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family Nin-like
Protein Properties Length: 913aa    MW: 101812 Da    PI: 5.82
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_015660genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK88.36.3e-28593643252
       RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                  e +isl++l++yF++++kdAA ++gvc+T+LKriCRq+GI+RWP+Rkik++
  DCAR_015660 593 ERTISLQVLRQYFAGSLKDAAASIGVCPTTLKRICRQHGISRWPSRKIKKV 643
                  789**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.881577663IPR003035RWP-RK domain
PfamPF020422.4E-24595643IPR003035RWP-RK domain
SuperFamilySSF542771.82E-20804898No hitNo description
Gene3DG3DSA:3.10.20.2404.0E-22811894No hitNo description
PROSITE profilePS5174522.463812897IPR000270PB1 domain
SMARTSM006661.3E-22812897IPR000270PB1 domain
CDDcd064071.49E-36813896No hitNo description
PfamPF005641.6E-15813896IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 913 aa     Download sequence    Send to blast
MDSGAPLTPN NMLATLSDNN MDFDLMDTLF DDGCWLAASP SNFWPQGLSP VASDFSSYYF  60
STTDADNINH LEPNSLQEDF QEEEERLNYS ENVRLVWETS ASLAPESSLV DGNRMNTSLW  120
IPPSEDPNST TSVKNKLFQA FEHLKHHTRD DFLIQIWVPV KKEGQNVLST NNQPFSLDPK  180
SKSLEWYRNV SSNYQFAAQE DSKEYFGLPG RVFLKKLPEW TADVRRLRRE DFPRIDYAQQ  240
CNVRGSIALP VFERGSGACL GVVEIVTTGP DCRPELDDVC KALEDREEVA EIKEILTSVC  300
KRQNLPLAQT WVPCTQQSTE QCRSNGDMAC LSVDASACYY VQDEQVLSFH EACCKKHLLS  360
NEGVVGRALM TNHPCFTTEI SAFNEIEYPL AYHAKMARLH GAVAIRFRSI YTDSISFIIE  420
FFLPIDCKDL EEQKQSVSLL SSQIRQLCHG SHFLPDVEIE TENLSPVREN SPPGGRLVEE  480
IHTKFVSSSS SEEATRDELS WISQMLEAQQ KGNGISVSLG NQKQEPEDFN MNTDWIIPDG  540
RFFSSGAEPS LHKNIVQDKS RGTAKNGVEL SSVKGQRSSG AKKAGEHRKL KAERTISLQV  600
LRQYFAGSLK DAAASIGVCP TTLKRICRQH GISRWPSRKI KKVGHSLKKL QLVIDSVQGS  660
EGAIQLSSFY TNFPELSSQN VTGTSSLSPS KIDNQLKPQP TQHRESLLSP ATTASQSTSS  720
SSPSSSSSYC CSTEAKEAKV NANFSGTGDA PPAVGVLKRA LSDAKLHDSV QEDTKFLVRS  780
HSYKLFSELP PLGSLIPPQK GNNNQALKNG TSFRVKATLG EEKIRFSMPQ YWGFTDLQRE  840
ISRRFNIDIE DVNKLDLRYL DEDSEWILLT CNDDLVECID IHRSSKSHTI KLSLRHSRYP  900
NLGSSLDSCG PS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017247359.10.0PREDICTED: protein NLP2
RefseqXP_017247360.10.0PREDICTED: protein NLP2
RefseqXP_017247361.10.0PREDICTED: protein NLP2
RefseqXP_017247362.10.0PREDICTED: protein NLP2
TrEMBLA0A165A6540.0A0A165A654_DAUCS; Uncharacterized protein
STRINGVIT_03s0038g03710.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15982467
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.10.0Nin-like family protein