PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_015630
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family GRAS
Protein Properties Length: 533aa    MW: 58842.4 Da    PI: 4.5008
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_015630genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS90.82.2e-283834961117
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  l++lL++cA+ v+s+d + a++ L+ +++ +s +gd+ qRla  f+++L+ar+a+++++ly+al++++ s    +e+l+a++++ +++P+ k s + a
  DCAR_015630 383 LRTLLISCAQSVASEDRRTAHEQLKLIRQYSSASGDASQRLANIFANGLEARMAGTGTQLYAALSSRRIS---ATEKLKAYQAYLKACPFKKTSVFFA 477
                  6789**************************************************************9999...9************************ PP

         GRAS  99 NqaIleavegeervHiiDf 117
                  N++Ile  ++++++HiiDf
  DCAR_015630 478 NKMILEKSSTATTLHIIDF 496
                  ******************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098522.181357532IPR005202Transcription factor GRAS
PfamPF035147.5E-26383496IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009410Biological Processresponse to xenobiotic stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
Sequence ? help Back to Top
Protein Sequence    Length: 533 aa     Download sequence    Send to blast
MVMDPGSTDF SDVLNGFEFG DEVVLPGFDS PPNYANTFKF KDELVDLSFL DIPDVQPEPD  60
YAGPATNTST STVNNTSPTG SSEMYSPEDN DDGVLKFLNQ ILMEEKIEEK PSMFYDPLAL  120
QAAEQSLYEA LGKQYPPSYG SGDVYQHADS PYDYFTGSSS EYSTSSGGTT AGNYYEPPHW  180
VADSVSLKSS TVQHQPSDYN IDSRSQWSVT SENSLNNNLS GVLDSPMSTQ VIPNIFSDRD  240
SILQFKRGME EASKFLPKIP QLVVNLDNYA LRSDTKEGPP VLQVKVEKDE EIAFSSLRGR  300
KHLLQQDSVV EDERSSKQLA VYEEEVEITE LFDKVLLSGP CCDKEEPIEF SPAFHHENGL  360
AHGSNGGKSR FKKTDSTSEA VDLRTLLISC AQSVASEDRR TAHEQLKLIR QYSSASGDAS  420
QRLANIFANG LEARMAGTGT QLYAALSSRR ISATEKLKAY QAYLKACPFK KTSVFFANKM  480
ILEKSSTATT LHIIDFVLCT DNSIVAKLEI TARLHSCKND LKAQRLEVVN FD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017247291.10.0PREDICTED: scarecrow-like protein 14
TrEMBLA0A165A6W00.0A0A165A6W0_DAUCS; Uncharacterized protein
STRINGSolyc06g076280.1.11e-134(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27624191
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.15e-87SCARECROW-like 14