PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_015531
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family G2-like
Protein Properties Length: 298aa    MW: 34079.3 Da    PI: 7.18
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_015531genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like79.63.9e-25117170154
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54 
                  kprl+Wt+eLHerF +a ++LGG  kAtPk+il+ m+v g+t++++kSHLQk R
  DCAR_015531 117 KPRLNWTHELHERFNHAAQELGGYFKATPKAILQKMNVRGVTNDQIKSHLQKVR 170
                  79**************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.148114174IPR017930Myb domain
SuperFamilySSF466898.6E-14115172IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-23116172IPR009057Homeodomain-like
TIGRFAMsTIGR015575.4E-22117172IPR006447Myb domain, plants
PfamPF002499.3E-6119169IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MATHQRSQMT NMNIPVVPPE FAPIQPRFGE NQFMSFYGQH QTMMNPSYQE HVSYPVHQTP  60
SLDFSFQQGQ MMDNAKFYPE GFCYQYSVQI WTDHLEGNVA ANGLVVELER PSFSLKKPRL  120
NWTHELHERF NHAAQELGGY FKATPKAILQ KMNVRGVTND QIKSHLQKVR NRVLNTSSTS  180
KILNGETYST PNFDSNIGEH EHLHKSSEAL VAQEPKINKE KAALKLKNKE QEEDEKNEAD  240
NMDVLEVGEN DFYTIEKLDE VVLSMTYLAR KSSNIRFKKL GIFKGKGQSS SSNINFN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017233368.17e-48PREDICTED: uncharacterized protein LOC108207431
TrEMBLA0A165A8Q80.0A0A165A8Q8_DAUCS; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.21e-15G2-like family protein