PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_015061
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family LBD
Protein Properties Length: 171aa    MW: 18741.2 Da    PI: 7.3613
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_015061genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.42.1e-42101091100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrrkC  +C++apyfp e+p+kfa+vhk+FGasnv+kll ++ +++reda++sl+yeA+ar++dPvyG+vg i+ lqqq+ +l++el++++
  DCAR_015061  10 PCAACKFLRRKCILGCIFAPYFPPEEPQKFAYVHKIFGASNVSKLLLEILPHQREDAVNSLAYEADARIKDPVYGCVGAISVLQQQVIRLQKELDATN 107
                  7*********************************************************************************************9987 PP

       DUF260  99 ee 100
                  ++
  DCAR_015061 108 AS 109
                  65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.5219110IPR004883Lateral organ boundaries, LOB
PfamPF031952.5E-4110107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MASPSYTNSP CAACKFLRRK CILGCIFAPY FPPEEPQKFA YVHKIFGASN VSKLLLEILP  60
HQREDAVNSL AYEADARIKD PVYGCVGAIS VLQQQVIRLQ KELDATNASL LRYTSNNDNR  120
ITLHSHSAIL PSRQGTFCFG HNDAGLSLPC NCSYSLNQDS GDANEGERNT *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-6081139114LOB family transfactor Ramosa2.1
5ly0_B3e-6081139114LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017244816.11e-125PREDICTED: LOB domain-containing protein 25-like
RefseqXP_017244817.11e-125PREDICTED: LOB domain-containing protein 25-like
SwissprotQ8L8Q32e-62LBD25_ARATH; LOB domain-containing protein 25
TrEMBLA0A165WQF91e-123A0A165WQF9_DAUCS; Uncharacterized protein
STRINGXP_010108819.17e-70(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.17e-65LOB domain-containing protein 25
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]