PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_014854
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family G2-like
Protein Properties Length: 427aa    MW: 47583.2 Da    PI: 7.3333
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_014854genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.46e-32231286156
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                  k+r++W+p+LH+rFv+a++ LGGs++AtPk+i+e+mkv+gLt+++vkSHLQkYRl+
  DCAR_014854 231 KARRCWSPDLHRRFVNALQMLGGSQVATPKQIREVMKVDGLTNDEVKSHLQKYRLH 286
                  68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.085228288IPR017930Myb domain
SuperFamilySSF466891.97E-16228289IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.7E-28229289IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-26231286IPR006447Myb domain, plants
PfamPF002491.5E-6233284IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MMASPSELTL HCKPHNTYSM LLKSSGAEQA TATNDQTQTQ KLEDFLSCLE KECNEIEAFK  60
RELPLCMQLL NNAMETFRQE LQTCSASQGQ RPVAEELVMK VQSSSDCSEM TSNMSDNKSN  120
WMNSAQLWSQ TNDTTKQPTT PSKETHDVPK LRLDAKQRNG GGFLPFSNER ISRPCTIGAL  180
PDLALVSVDK EIKDKKWVER NQGKRAISED PQSISTNNGF TSTTSPQTHR KARRCWSPDL  240
HRRFVNALQM LGGSQVATPK QIREVMKVDG LTNDEVKSHL QKYRLHTRRP SPNPQSAGPA  300
ASQLVVLGGI WLPSEYAAAH HGGAPPLYGL HPAHVKSQHY IVPQEYYSAV APQAQGHHQL  360
HNHTLHHQLH IYNQPSPQIH GSPESDARGN TTDQSERMKD RKSDKEALVP GEDGEESNES  420
DITLKF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A6e-14231284255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B6e-14231284255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A6e-14231284255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C6e-14231284255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D6e-14231284255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F6e-14231284255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H6e-14231284255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J6e-14231284255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor acting as a flowering repressor, directly repressing FT expression in a dosage-dependent manner in the leaf vasculature. {ECO:0000269|PubMed:25132385}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by SVP. Down-regulated by high temperature and gibberellic acid treatment. Not regulated by photoperiod, circadian rhythm under long days or vernalization. {ECO:0000269|PubMed:25132385}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017246448.10.0PREDICTED: uncharacterized protein LOC108218036
SwissprotQ9ZQ851e-101EFM_ARATH; Myb family transcription factor EFM
TrEMBLA0A165WYZ10.0A0A165WYZ1_DAUCS; Uncharacterized protein
STRINGevm.model.supercontig_127.551e-141(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA87942229
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-102G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]